0022066801 - I KETUT BUDARAGA
No Kategori Kegiatan Authors Judul Kegiatan Publikasi Cited Quality Tahun Kegiatan
1 Google Scholar Authors : IK Budaraga Pengawasan Mutu Agroindustri Berbasis OBE CV HEI PUBLISHING INDONESIA, 2026 0 2026
2 Google Scholar Authors : IK Budaraga Future Foods: Future Food Innovation Based on Local Wisdom and Sustainability Mawadra Lestari Enterprise, 2026 0 2026
3 Google Scholar Authors : IK Budaraga POSTHARVEST PHYSIOLOGY AND TECHNOLOGY BASED ON OBE Mawadra Lestari Enterprise (MLE), 2025 0 2025
4 Google Scholar Authors : IK Budaraga POSTHARVEST PHYSIOLOGY AND TECHNOLOGY BASED ON OBE Mawadra Lestari Enterprise (MLE), 2025 0 2025
5 Google Scholar Authors : AS Fatmawaty, IK Budaraga, GIA Yekti, R Rizkyanto Konsep Dasar Pengantar Pangan Hei Publishing, 2025 0 2025
6 Google Scholar Authors : AS Fatmawaty, IK Budaraga, GIA Yekti, R Rizkyanto Konsep Dasar Pengantar Pangan Hei Publishing, 2025 0 2025
7 Google Scholar Authors : IK Budaraga, I Sidabalok, SA Rasyid Characteristics of pensi pempek (Corbicula moltkiana) on tapioca flour substitution with sago flour BIO Web of Conferences 159, 01006, 2025 0 2025
8 Google Scholar Authors : IK Budaraga Keamanan Pangan dan Nutrisi CVLauk Puyu Press, 2025 0 2025
9 Google Scholar Authors : Z Mustakim, EA Fitria, IK Budaraga, N Yessirita Pendugaan Umur Simpan Sosis Ikan Patin (Pangasius sp) Yang Dilapisi Edible Coating Pati Talas Antimikroba Sari Belimbing Wuluh (Averrhoa bilimbi L) Jurnal Research Ilmu Pertanian 5 (2), 199-210, 2025 1 2025
10 Google Scholar Authors : Z Mustakim, EA Fitria, IK Budaraga, N Yessirita Pendugaan Umur Simpan Sosis Ikan Patin (Pangasius sp) Yang Dilapisi Edible Coating Pati Talas Antimikroba Sari Belimbing Wuluh (Averrhoa bilimbi L) Jurnal Research Ilmu Pertanian 5 (2), 199-210, 2025 1 2025
11 Google Scholar Authors : IK Budaraga, I Sidabalok, SA Rasyid Characteristics of pensi pempek (Corbicula moltkiana) on tapioca flour substitution with sago flour BIO Web of Conferences 159, 01006, 2025 0 2025
12 Google Scholar Authors : IK Budaraga, RA Salihat, EA Fitria Teknologi Dan Karakteristik Keju Lunak: Produksi, Mutu, Dan Inovasi Hei Publishing, 2025 0 2025
13 Google Scholar Authors : IK Budaraga, RA Salihat, EA Fitria Teknologi Dan Karakteristik Keju Lunak: Produksi, Mutu, Dan Inovasi Hei Publishing, 2025 0 2025
14 Google Scholar Authors : IK Budaraga Keamanan Pangan dan Nutrisi CVLauk Puyu Press, 2025 0 2025
15 Google Scholar Authors : IK Budaraga The Role of Social Media in the Formation of Adolescent Identity: A Review of Psychology and Popular Culture Journal of Dialogos 2 (3), 46-56, 2025 0 2025
16 Google Scholar Authors : R Chaniago TEKNOLOGI PENGOLAHAN DAN HASIL PERTANIAN 0 2024
17 Google Scholar Authors : IK Budaraga, EA Fitria, S Susilawati The Identification of Salmonella SP on Food Preparations (Seasoning and Rakik Chips) in Padang City Proceeding International Conference Khairun University 1 (1), 266-271, 2024 0 2024
18 Google Scholar Authors : IGSDARUPERHJDLUAIKBGEMMNKANAMSK Putri lmu Bahan Pangan IN Patent EC00,202,432,262, 2024 0 2024
19 Google Scholar Authors : IK Budaraga Laporan Ilmiah Hei Publishing Indonesia, 2024 0 2024
20 Google Scholar Authors : Sugiarti, S Devi Kumala, S Debby, Z Engki, F Nelzi, Nilawati, M Ahmad, ... ILMU TEKNOLOGI HASIL TERNAK 0 2024
21 Google Scholar Authors : IK Budaraga, EA Fitria, S Susilawati The Identification of Salmonella SP on Food Preparations (Seasoning and Rakik Chips) in Padang City Proceeding International Conference Khairun University 1 (1), 266-271, 2024 0 2024
22 Google Scholar Authors : IGSDARUPERHJDLUAIKBGEMMNKANAMSK Putri lmu Bahan Pangan IN Patent EC00,202,432,262, 2024 0 2024
23 Google Scholar Authors : IK Budaraga Laporan Ilmiah Hei Publishing Indonesia, 2024 0 2024
24 Google Scholar Authors : IK Budaraga Pengolahan Biogas Hei Publishing Indonesia, 2024 0 2024
25 Google Scholar Authors : IK Budaraga Ilmu Sagu Hei Publishing Indonesia, 2024 0 2024
26 Google Scholar Authors : IK Budaraga, EA Fitria, S Susilawati The Identification of Salmonella SP on Food Preparations (Seasoning and Rakik Chips) in Padang City Proceeding International Conference Khairun University 1 (1), 266-271, 2024 0 2024
27 Google Scholar Authors : MPWPRUBIKBTKHSMRHCYSADPG Setiavani Buku Teknologi Pengolahan Hasil Perkebunan IN Patent EC00,202,444,712, 2024 0 2024
28 Google Scholar Authors : IK Budaraga Uji Beda Pada Uji Sensoris Bahan Pangan Hei Publishing Indonesia, 2024 0 2024
29 Google Scholar Authors : HTPSKDYHAFAPBEMITQAAFESIK Budaraga Buku Konsep Pemberdayaan Masyarakat IN Patent EC00,202,449,833, 2024 0 2024
30 Google Scholar Authors : IK Budaraga Model-Model Pemberdayaan Masyarakat Hei Publishing Indonesia, 2024 1 2024
31 Google Scholar Authors : AC MUSTIKANINGRUM ILMU BAHAN PANGAN Media Sains Indonesia, 2024 0 2024
32 Google Scholar Authors : MIFGAPRERMSIRIKBSSSRNSDANNZN Fayyadh Buku Teknik Evaluasi Sensori Produk Pangan IN Patent EC00,202,445,806, 2024 0 2024
33 Google Scholar Authors : MIF Gunawan, AP Riandani, ERM Saleh, I Rodianawati, IK Budaraga, ... Teknik evaluasi sensori produk pangan CV Hei Publishing Indonesia, 2024 7 2024
34 Google Scholar Authors : DP Budaraga, I.K. , Putra Study of liquid smoke toxicity cocoa shell with different purification methods8 IOP Conference Series: Earth and Environmental Science 1 (IOP), 8, 2024 0 2024
35 Google Scholar Authors : IK Budaraga Faktor Proses Pengolahan Dengan Pemanasan Hei Publishing Indonesia, 2024 1 2024
36 Google Scholar Authors : IK Budaraga Laporan Ilmiah Hei Publishing Indonesia, 2024 0 2024
37 Google Scholar Authors : IK Budaraga Teknologi Ekstruksi Pada Pangan Hei Publishing Indonesia, 2024 0 2024
38 Google Scholar Authors : IK Budaraga, L Hermalena, S Aisyah Alginate Addition from Sargassum Seaweed (Sargassum sp.) on Pumpkin Ice Cream (Cucurbita Moschata Durch.) Characteristics Annals of Agri-Bio Research 29 (2), 15-26, 2024 1 2024
39 Google Scholar Authors : AA I Ketut Budaraga Buku Peranan Teknologi Pengolahan Dan Pengawetan Pangan Berbasis Sumber Daya Dan Kearifan Lokal Untuk Mewujudkan Pangan Sehat IN Patent EC00,202,420,497, 2024 0 2024
40 Google Scholar Authors : IK Budaraga Pengolahan Biogas Hei Publishing Indonesia, 2024 0 2024
41 Google Scholar Authors : Sugiarti, S Devi Kumala, S Debby, Z Engki, F Nelzi, Nilawati, M Ahmad, ... ILMU TEKNOLOGI HASIL TERNAK 0 2024
42 Google Scholar Authors : I Sitepu, H Sa’diyah, M Zuhri, NN Lailisna, Khairiah, Fitra, Azmi, S Azizah, ... Filsafat Ilmu dan Metode Ilmiah HEI PUBLISHING INDONESIA, 2024 0 2024
43 Google Scholar Authors : IGSDARUPERHJDLUAIKBGEMMNKANAMSK Putri lmu Bahan Pangan IN Patent EC00,202,432,262, 2024 0 2024
44 Google Scholar Authors : IK Budaraga Laporan Ilmiah Hei Publishing Indonesia, 2024 0 2024
45 Google Scholar Authors : Sugiarti, S Devi Kumala, S Debby, Z Engki, F Nelzi, Nilawati, M Ahmad, ... ILMU TEKNOLOGI HASIL TERNAK 0 2024
46 Google Scholar Authors : S Nurjanah, K Syska, N Diniyah, IK Budaraga, G Setiavani, E Verawati Teknologi Tepat Guna Dan Ilmu Terapan Hei Publishing Indonesia, 2024 0 2024
47 Google Scholar Authors : IK Budaraga, L Hermalena, S Aisyah Alginate Addition from Sargassum Seaweed (Sargassum sp.) on Pumpkin Ice Cream (Cucurbita Moschata Durch.) Characteristics Annals of Agri-Bio Research 29 (2), 15-26, 2024 1 2024
48 Google Scholar Authors : IK Budaraga Model-Model Pemberdayaan Masyarakat Hei Publishing Indonesia, 2024 1 2024
49 Google Scholar Authors : R Chaniago TEKNOLOGI PENGOLAHAN DAN HASIL PERTANIAN 0 2024
50 Google Scholar Authors : IK Budaraga, EA Fitria, S Susilawati The Identification of Salmonella SP on Food Preparations (Seasoning and Rakik Chips) in Padang City Proceeding International Conference Khairun University 1 (1), 266-271, 2024 0 2024
51 Google Scholar Authors : MIFGAPRERMSIRIKBSSSRNSDANNZN Fayyadh Buku Teknik Evaluasi Sensori Produk Pangan IN Patent EC00,202,445,806, 2024 0 2024
52 Google Scholar Authors : MIF Gunawan, AP Riandani, ERM Saleh, I Rodianawati, IK Budaraga, ... Teknik evaluasi sensori produk pangan CV Hei Publishing Indonesia, 2024 7 2024
53 Google Scholar Authors : AA I Ketut Budaraga Buku Peranan Teknologi Pengolahan Dan Pengawetan Pangan Berbasis Sumber Daya Dan Kearifan Lokal Untuk Mewujudkan Pangan Sehat IN Patent EC00,202,420,497, 2024 0 2024
54 Google Scholar Authors : IK Budaraga Pengolahan Biogas Hei Publishing Indonesia, 2024 0 2024
55 Google Scholar Authors : IK Budaraga Teknologi Ekstruksi Pada Pangan Hei Publishing Indonesia, 2024 0 2024
56 Google Scholar Authors : IK Budaraga Uji Beda Pada Uji Sensoris Bahan Pangan Hei Publishing Indonesia, 2024 0 2024
57 Google Scholar Authors : IK Budaraga Teknologi Pengolahan Kelapa Sawit Hei Publishing Indonesia, 2024 0 2024
58 Google Scholar Authors : MP Wisnubroto, P Juanti, RU Budiandari, IK Budaraga, T Kumala, ... TEKNOLOGI PENGOLAHAN HASIL PERKEBUNAN CV HEI PUBLISHING INDONESIA, 2024 0 2024
59 Google Scholar Authors : IK Budaraga, L Hermalena, S Aisyah Alginate Addition from Sargassum Seaweed (Sargassum sp.) on Pumpkin Ice Cream (Cucurbita Moschata Durch.) Characteristics Annals of Agri-Bio Research 29 (2), 15-26, 2024 1 2024
60 Google Scholar Authors : RDEKERMSDAPADPNEPEKHKRCPTFYSSNIK Budaraga Buku Teknologi Pengolahan Dan Hasil Pertanian IN Patent EC00,202,442,132, 2024 0 2024
61 Google Scholar Authors : IK Budaraga, M Aditiawarman, H Fandeli, W Sumarno, RA Syukra Teknologi Pengolahan Kelapa Terpadu: Beserta Berbagai Tutorial Pengolahan Pohon Kelapa Hei Publishing Indonesia, 2024 6 2024
62 Google Scholar Authors : IK Budaraga Teknologi Pengolahan Kelapa Sawit Hei Publishing Indonesia, 2024 0 2024
63 Google Scholar Authors : R Ropiudin, R Rusman, RE Rachmanita, IK Budaraga, DE Rahmanto, ... Teknologi Energi Terbarukan Hei Publishing Indonesia, 2024 4 2024
64 Google Scholar Authors : IK Budaraga Telur Sebagai Bahan Pangan Hei Publishing Indonesia, 2024 0 2024
65 Google Scholar Authors : DI Setiawan, K Kaluku, ASV Nababan, GPE Mulyo, Nafilah, ... Ilmu Bahan Pangan 0 2024
66 Google Scholar Authors : IK Budaraga, DP Putra Study of liquid smoke toxicity cocoa shell with different purification methods IOP Conference Series: Earth and Environmental Science 1306 (1), 012003, 2024 1 2024
67 Google Scholar Authors : I Sitepu, H Sa’diyah, M Zuhri, NN Lailisna, Khairiah, Fitra, Azmi, S Azizah, ... Filsafat Ilmu dan Metode Ilmiah HEI PUBLISHING INDONESIA, 2024 0 2024
68 Google Scholar Authors : S Nurjanah, K Syska, N Diniyah, IK Budaraga, G Setiavani, E Verawati Teknologi tepat Guna dan Teknologi Terapan CV Hei Publishing Indonesia, 2024 1 2024
69 Google Scholar Authors : HT Pakpahan, S Kurniasih, Y Heryadi, A Fauziah, A Eka, I Tahir, ... Konsep pemberdayaan masyarakat Padang: CV HEI Publishing Indonesia, 2024 24 2024
70 Google Scholar Authors : IK Budaraga Telur Sebagai Bahan Pangan Hei Publishing Indonesia, 2024 0 2024
71 Google Scholar Authors : IK Budaraga Uji Beda Pada Uji Sensoris Bahan Pangan Hei Publishing Indonesia, 2024 0 2024
72 Google Scholar Authors : IK Budaraga Teknologi Pengolahan Kelapa Sawit Hei Publishing Indonesia, 2024 0 2024
73 Google Scholar Authors : MP Wisnubroto, P Juanti, RU Budiandari, IK Budaraga, T Kumala, ... TEKNOLOGI PENGOLAHAN HASIL PERKEBUNAN CV HEI PUBLISHING INDONESIA, 2024 0 2024
74 Google Scholar Authors : AH Samudra, RA Salihat, IK Budaraga Characteristics of Brown Rice (Oryza nivara) Stored Using Various Packaging with The Addition of Pandanus Powder (Pandanus amaryllifolius Roxb.) Springer Nature, 2023 0 2023
75 Google Scholar Authors : I Ketut-Budaraga KAJIAN SIFAT FISIKOKIMIA DAN ORGANOLEPTIK SUSU SAPI MURNI DENGAN PENAMBAHAN ASAP CAIR SELAMA PENYIMPANAN Jurnal Teknologi Pertanian Andalas 27 (2), 221-228, 2023 0 2023
76 Google Scholar Authors : IK Budaraga, L Hermalena, I Ahsan Characteristics of Maco Fish (Leiognathidae Spelendes) Using Coconut Shell Liquid Smoke as A Natural Preservative BIO Web of Conferences 69, 03003, 2023 0 2023
77 Google Scholar Authors : IK Budaraga Pengaruh Pemanenan dan Penanganan Terhadap Gizi Pangan Hei Publishing Indonesia, 2023 1 2023
78 Google Scholar Authors : IK Budaraga, RA Salihat, EA Fitria Acidification effects of starfruit (Averrhoa bilimbi L.) on soy milk-based cottage cheese: a physicochemical and organoleptic assessment Potravinarstvo Slovak Journal of Food Sciences 17, 986-996, 2023 4 2023
79 Google Scholar Authors : IK Budaraga Application of Chitosan Coating and Liquid Smoke as Antimicrobial Agent in Tuna Fish Pempek Jurnal Gizi dan Pangan, 2023 1 2023
80 Google Scholar Authors : IK Budaraga Pengaruh Pemanenan dan Penanganan Terhadap Gizi Pangan Hei Publishing Indonesia, 2023 1 2023
81 Google Scholar Authors : IK Budaraga Application of Chitosan Coating and Liquid Smoke as Antimicrobial Agent in Tuna Fish Pempek Jurnal Gizi dan Pangan, 2023 1 2023
82 Google Scholar Authors : IK Budaraga Pengaruh Pemanenan dan Penanganan Terhadap Gizi Pangan Hei Publishing Indonesia, 2023 1 2023
83 Google Scholar Authors : IK Budaraga Application of Chitosan Coating and Liquid Smoke as Antimicrobial Agent in Tuna Fish Pempek Jurnal Gizi dan Pangan, 2023 1 2023
84 Google Scholar Authors : RA Salihat, IK Budaraga, D Syukri, NR Yanti, EA Fitria The effect of addition of wuluh starfruit (Averrhoa bilimbi L.) juice as a coagulant in cottage cheese from cow’s milk Annals of Agri-Bio Research 28 (2), 328-336, 2023 2 2023
85 Google Scholar Authors : I Ketut-Budaraga KAJIAN SIFAT FISIKOKIMIA DAN ORGANOLEPTIK SUSU SAPI MURNI DENGAN PENAMBAHAN ASAP CAIR SELAMA PENYIMPANAN Jurnal Teknologi Pertanian Andalas 27 (2), 221-228, 2023 0 2023
86 Google Scholar Authors : IK Budaraga, DP Putra Antioxidant study of the gambier leaves by-products into tea with red ginger powder addition (Zingiber officinale var. Rubrum) AIP Conference Proceedings 2583 (1), 090023, 2023 1 2023
87 Google Scholar Authors : IK Budaraga, EA Fitria -Maize Nugget Making in Nagari Ladang Panjang, Pasaman Regency, West Sumatra Dinamisia: Jurnal Pengabdian Kepada Masyarakat 7 (4), 1184-1189, 2023 1 2023
88 Google Scholar Authors : IK Budaraga Alat Pembuat Asap cair dengan Sistem Vakum 0 2023
89 Google Scholar Authors : IK Budaraga Alat Pembuat Asap cair dengan Sistem Vakum 0 2023
90 Google Scholar Authors : IK Budaraga, M Sentia Study of determination of benzoic acid, ascorbic acid in food using high performance liquid chromatography (HPLC) method AIP Conference Proceedings 2765 (1), 020006, 2023 0 2023
91 Google Scholar Authors : IK Budaraga Alat Pembuat Asap cair dengan Sistem Vakum 0 2023
92 Google Scholar Authors : AP Kamarudin, E Sutrisno, Akhmaddhian, Suwari, E Wisdawati, SI Tito, ... Ketahanan Pangan dan Kearifan lokal Perkumpulan Rumah Cemerlang Indonesia, 2023 0 2023
93 Google Scholar Authors : IK Budaraga, RA Salihat, EA Fitria The study of the utilization of wuluh starfruit (Averrhoa bilimbi L.) in cottage cheese from goat milk prepared with acidification method based on physicochemical properties … Bulgarian Journal of Agricultural Science 20 (5), 2023 5 2023
94 Google Scholar Authors : IK Budaraga, WS Devi Pengabdian Kepada Masyarakat Penerapan Teori Kaizen untuk Meningkatan Kualitas Usaha Keripik Talas di UKM Asyifa Oleh-Oleh SEMAR (Jurnal Ilmu Pengetahuan, Teknologi, Dan Seni Bagi Masyarakat) 12 (1), 41, 2023 2 2023
95 Google Scholar Authors : IK Budaraga, RA Salihat, EA Fitria The study of the utilization of wuluh starfruit (Averrhoa bilimbi L.) in cottage cheese from goat milk prepared with acidification method based on physicochemical properties … Bulgarian Journal of Agricultural Science 20 (5), 2023 5 2023
96 Google Scholar Authors : IK Budaraga, RA Salihat, EA Fitria The study of the utilization of wuluh starfruit (Averrhoa bilimbi L.) in cottage cheese from goat milk prepared with acidification method based on physicochemical properties … Bulgarian Journal of Agricultural Science 20 (5), 2023 5 2023
97 Google Scholar Authors : IK Budaraga, Y Novera The quality characteristics of biscuits made with plantain and purple rice flour as substitutes for wheat flour. Slovak Journal of Food Sciences 17, 2023 1 2023
98 Google Scholar Authors : IK Budaraga, L Hermalena, I Ahsan Characteristics of Maco Fish (Leiognathidae Spelendes) Using Coconut Shell Liquid Smoke as A Natural Preservative BIO Web of Conferences 69, 03003, 2023 0 2023
99 Google Scholar Authors : IK Budaraga, Y Novera The quality characteristics of biscuits made with plantain and purple rice flour as substitutes for wheat flour. Slovak Journal of Food Sciences 17, 2023 1 2023
100 Google Scholar Authors : EA Fitria, IK Budaraga, RA Salihat The effect of wuluh starfruit (Averrhoa bilimbi L.) added on the physicochemical and antimicrobial characteristics of chitosan-PVA edible film Future of Food: Journal on Food, Agriculture and Society 11 (5), 2023 3 2023
101 Google Scholar Authors : IK Budaraga Alat Pembuat Asap cair dengan Sistem Vakum 0 2023
102 Google Scholar Authors : RA Salihat, IK Budaraga, D Syukri, NR Yanti, EA Fitria The effect of addition of wuluh starfruit (Averrhoa bilimbi L.) juice as a coagulant in cottage cheese from cow’s milk Annals of Agri-Bio Research 28 (2), 328-336, 2023 2 2023
103 Google Scholar Authors : I Ketut-Budaraga KAJIAN SIFAT FISIKOKIMIA DAN ORGANOLEPTIK SUSU SAPI MURNI DENGAN PENAMBAHAN ASAP CAIR SELAMA PENYIMPANAN Jurnal Teknologi Pertanian Andalas 27 (2), 221-228, 2023 0 2023
104 Google Scholar Authors : IK Budaraga, EA Fitria -Maize Nugget Making in Nagari Ladang Panjang, Pasaman Regency, West Sumatra Dinamisia: Jurnal Pengabdian Kepada Masyarakat 7 (4), 1184-1189, 2023 1 2023
105 Google Scholar Authors : AH Samudra, RA Salihat, IK Budaraga Characteristics of Brown Rice (Oryza nivara) Stored Using Various Packaging with The Addition of Pandanus Powder (Pandanus amaryllifolius Roxb.) Springer Nature, 2023 0 2023
106 Google Scholar Authors : RA Salihat, IK Budaraga, D Syukri, NR Yanti, EA Fitria The effect of addition of wuluh starfruit (Averrhoa bilimbi L.) juice as a coagulant in cottage cheese from cow’s milk Annals of Agri-Bio Research 28 (2), 328-336, 2023 2 2023
107 Google Scholar Authors : IK Budaraga, A Asnurita, Y Novera The quality characteristics of biscuits made with plantain and purple rice flour as substitutes for wheat flour Potravinarstvo Slovak Journal of Food Sciences 17, 69-81, 2023 1 2023
108 Google Scholar Authors : AP Kamarudin, E Sutrisno, Akhmaddhian, Suwari, E Wisdawati, SI Tito, ... Ketahanan Pangan dan Kearifan lokal Perkumpulan Rumah Cemerlang Indonesia, 2023 0 2023
109 Google Scholar Authors : IK Budaraga, M Sentia Study of determination of benzoic acid, ascorbic acid in food using high performance liquid chromatography (HPLC) method AIP Conference Proceedings 2765 (1), 020006, 2023 0 2023
110 Google Scholar Authors : IK Budaraga, DP Putra, Y Yanti Microbial activities and minimum liquid smoke killing concentration made of cacao pod toward Lasiodiplodia theobromae growth IOP Conference Series: Earth and Environmental Science 1059 (1), 012068, 2022 3 2022
111 Google Scholar Authors : IK Budaraga Proses Pembuatan Asap Cair Dengan Sistem Vakum 0 2022
112 Google Scholar Authors : EA Fitria, IK Budaraga, S Zebua Pengujian Asam Lemak Bebas Pada Wajik Yang Dilapisi Edible Film Khitosan-Pva SAGU Journal–Agri. Sci. Tech 22 (1), 38-42, 2022 3 2022
113 Google Scholar Authors : IK Budaraga, M Risti, W Sumarno PENGABDIAN KEPADA MASYARAKAT PENINGKATAN KUALITAS PRODUKSI TAHU DI USAHA TAHU PAKDE IPONG LOGISTA-Jurnal Ilmiah Pengabdian kepada Masyarakat 6 (1), 91-97, 2022 0 2022
114 Google Scholar Authors : IK Budaraga, DP Putra, Y Yanti Microbial activities and minimum liquid smoke killing concentration made of cacao pod toward Lasiodiplodia theobromae growth IOP Conference Series: Earth and Environmental Science 1059 (1), 012068, 2022 3 2022
115 Google Scholar Authors : IK Budaraga, DP Putra Study of Antioxidant Liquid Smoke Cacao Fruit Peel Waste at Different Water Content and Pyrolysis Temperatures 0 2022
116 Google Scholar Authors : E Aidila Fitria, I Ketut Budaraga, S Zebua Pengujian Asam Lemak Bebas Pada Wajik Yang Dilapisi Edible Film Khitosan-Pva Testing of Free Fatty Acids on a Wajik Coated Edible Film Khitosan-Pva SAGU Journal: Agricultural Science and Technology 21 (1), 38-42, 2022 0 2022
117 Google Scholar Authors : I Ketut Budaraga, RA Salihat Heavy metals analysis (Cd, Pb, Zn, Cu, Cr) and calcium in Padang and Padang Panjang fresh cow's milk IOP Conference Series: Earth and Environmental Science 1038 (1), 012076, 2022 2 2022
118 Google Scholar Authors : E Aidila Fitria, I Ketut Budaraga, S Zebua Pengujian Asam Lemak Bebas Pada Wajik Yang Dilapisi Edible Film Khitosan-Pva Testing of Free Fatty Acids on a Wajik Coated Edible Film Khitosan-Pva SAGU Journal: Agricultural Science and Technology 21 (1), 38-42, 2022 0 2022
119 Google Scholar Authors : IK Budaraga, DP Putra, Y Yanti Microbial activities and minimum liquid smoke killing concentration made of cacao pod toward Lasiodiplodia theobromae growth IOP Conference Series: Earth and Environmental Science 1059 (1), 012068, 2022 3 2022
120 Google Scholar Authors : W Budaraga I Ketut Pengabdian kepada Masyarakat Peningkatan Kualitas Usaha Keripik Talas Asyifa Oleh-oleh Seminar Nasional Pengabdian Fakultas Pertanian UNS Tahun 2021 1 (1), 172-180, 2022 0 2022
121 Google Scholar Authors : IK Budaraga, DP Putra Study of Antioxidant Liquid Smoke Cacao Fruit Peel Waste at Different Water Content and Pyrolysis Temperatures 0 2022
122 Google Scholar Authors : I Ketut Budaraga, RA Salihat Heavy metals analysis (Cd, Pb, Zn, Cu, Cr) and calcium in Padang and Padang Panjang fresh cow’s milk IOP Conference Series: Earth and Environmental Science 1038 (1), 012076, 2022 1 2022
123 Google Scholar Authors : W Budaraga I Ketut Pengabdian kepada Masyarakat Peningkatan Kualitas Usaha Keripik Talas Asyifa Oleh-oleh Seminar Nasional Pengabdian Fakultas Pertanian UNS Tahun 2021 1 (1), 172-180, 2022 0 2022
124 Google Scholar Authors : IK Budaraga, RA Salihat, EA Fitria Keju Cottage Dari Susu Sapi Dengan Penambahan Belimbing Wuluh 0 2022
125 Google Scholar Authors : AH Samudra, RA Salihat, IK Budaraga Characteristics of Brown Rice (Oryza nivara) Stored Using Various Packaging with The Addition of Pandanus Powder (Pandanus amaryllifolius Roxb.) International Conference on Sustainable Environment, Agriculture and Tourism …, 2022 0 2022
126 Google Scholar Authors : T Astina, A Asnurita, IK Budaraga Pengaruh Penambahan Ekstrak Gambir (Uncaria Gambir Roxb.) Sebagai Antibakteri Pada Pembuatan Sabun Padat Buram Jurnal Teknologi Pertanian Andalas 26 (2), 142-150, 2022 0 2022
127 Google Scholar Authors : IK Budaraga Proses Pembuatan Asap Cair Dengan Sistem Vakum 0 2022
128 Google Scholar Authors : I Ketut Budaraga, RA Salihat Heavy metals analysis (Cd, Pb, Zn, Cu, Cr) and calcium in Padang and Padang Panjang fresh cow’s milk IOP Conference Series: Earth and Environmental Science 1038 (1), 012076, 2022 3 2022
129 Google Scholar Authors : IK Budaraga, M Risti, W Sumarno Pengabdian Kepada Masyarakat Peningkatan Kualitas Produksi Tahu Di Usaha Tahu Pakde Ipong (Service To The Community Improving The Quality Of Touch Production In Business Tahu … Logista Jurnal Ilmiah Pengabdian kepada Masyarakat 6 (1), 91-97, 2022 0 2022
130 Google Scholar Authors : AH Samudra, RA Salihat, IK Budaraga Characteristics of Brown Rice (Oryza nivara) Stored Using Various Packaging with The Addition of Pandanus Powder (Pandanus amaryllifolius Roxb.) International Conference on Sustainable Environment, Agriculture and Tourism …, 2022 0 2022
131 Google Scholar Authors : I Ketut Budaraga, RA Salihat Heavy metals analysis (Cd, Pb, Zn, Cu, Cr) and calcium in Padang and Padang Panjang fresh cow's milk IOP Conference Series: Earth and Environmental Science 1038 (1), 012076, 2022 2 2022
132 Google Scholar Authors : E Aidila Fitria, I Ketut Budaraga, S Zebua Pengujian Asam Lemak Bebas Pada Wajik Yang Dilapisi Edible Film Khitosan-Pva Testing of Free Fatty Acids on a Wajik Coated Edible Film Khitosan-Pva SAGU Journal: Agricultural Science and Technology 21 (1), 38-42, 2022 0 2022
133 Google Scholar Authors : IK Budaraga, DP Putra Analysis antioxidant IC50 liquid smoke of cocoa skin with several purification methods IOP Conference Series: Earth and Environmental Science 757 (1), 012053, 2021 17 2021
134 Google Scholar Authors : IK Budaraga, W Sri Devi Pengabdian kepada masyarakat peningkatan kualitas usaha keripik talas Asyifa oleh-oleh 15 2021
135 Google Scholar Authors : IK Budaraga, F Maidija Pengabdian kepada Masyarakat Peningkatan Kualitas Kopi Solok Radjo Prosiding Seminar Nasional Pengabdian Kepada Masyarakat 1 (1), 181-190, 2021 4 2021
136 Google Scholar Authors : I Ketut Budaraga, RA Salihat Analysis of metals (Pb, Mn, Cd, Zn, Cu) in purple rice and purple rice stems cultivated organically using biogas slug in Padang Pariaman, West Sumatra Province IOP Conference Series: Earth and Environmental Science 709 (1), 012071, 2021 7 2021
137 Google Scholar Authors : R Ramaiyulis, N Nilawati, Y Eva, S Deby, IK Budaraga Potential and development of incubation technology to improve the quality of" dadih" as a specific food of minangkabau Livestock Research for Rural Development 33 (7), 2021 1 2021
138 Google Scholar Authors : I Ketut Budaraga, RA Salihat Analysis of metals (Pb, Mn, Cd, Zn, Cu) in purple rice and purple rice stems cultivated organically using biogas slug in Padang Pariaman, West Sumatra Province IOP Conference Series: Earth and Environmental Science 709 (1), 012071, 2021 7 2021
139 Google Scholar Authors : IK Budaraga, D Pramana Putra, Y Yanti Antimicrobial Activity and Liquid Smoke Minimum Kill Concentration of Cocoa Shell on the Growth of the Lasiodiplodia Theobromae Fungi 0 2021
140 Google Scholar Authors : IK Budaraga, DP Putra Analysis antioxidant IC50 liquid smoke of cocoa skin with several purification methods IOP Conference Series: Earth and Environmental Science 757 (1), 012053, 2021 17 2021
141 Google Scholar Authors : IK Budaraga, RA Salihat Heavy metals analysis (Cd, Pb, Zn, Cu, Cr) and calcium in Padang and Padang Panjang fresh cow’s milk 3 2021
142 Google Scholar Authors : IK Budaraga, RA Salihat The effect of material amount in distillation tank to chemical composition of citronella oil (Cymbopogon nardus L. Rendle) IOP Conference Series: Earth and Environmental Science 653 (1), 012043, 2021 4 2021
143 Google Scholar Authors : IK Budaraga, DP Putra Analysis antioxidant IC50 liquid smoke of cocoa skin with several purification methods IOP Conference Series: Earth and Environmental Science 757 (1), 012053, 2021 17 2021
144 Google Scholar Authors : IK Budaraga, W Sri Devi Pengabdian kepada masyarakat peningkatan kualitas usaha keripik talas Asyifa oleh-oleh 15 2021
145 Google Scholar Authors : R Ramaiyulis, N Nilawati, Y Eva, S Deby, IK Budaraga Potential and development of incubation technology to improve the quality of" dadih" as a specific food of minangkabau Livestock Research for Rural Development 33 (7), 2021 1 2021
146 Google Scholar Authors : S Wilanda, N Yessirita, IK Budaraga Kajian Mutu Dan Aktivitas Antioksidan Teh Kulit Kopi (Coffeacanephora) Dengan Penambahan Daun Mint (Mentha Piperita L) Jurnal Research Ilmu Pertanian 1 (1), 76-83, 2021 14 2021
147 Google Scholar Authors : D Syukriani, Ramaiyulis, Nilawati, E Yulia, IK Budaraga Potential and development of incubation technology to improve the quality of" dadih" as a specific food of minangkabau. 0 2021
148 Google Scholar Authors : I Ketut Budaraga, RA Salihat Analysis of metals (Pb, Mn, Cd, Zn, Cu) in purple rice and purple rice stems cultivated organically using biogas slug in Padang Pariaman, West Sumatra Province IOP Conference Series: Earth and Environmental Science 709 (1), 012071, 2021 7 2021
149 Google Scholar Authors : IK Budaraga, D Pramana Putra, Y Yanti Antimicrobial Activity and Liquid Smoke Minimum Kill Concentration of Cocoa Shell on the Growth of the Lasiodiplodia Theobromae Fungi 0 2021
150 Google Scholar Authors : IK Budaraga, N Yulita, N Yessirita Antibacterial study of cocoa skin liquid smoke in raw milk IOP Conference Series: Earth and Environmental Science 803 (1), 012034, 2021 5 2021
151 Google Scholar Authors : I Ketut Budaraga, RA Salihat Analysis of metals (Pb, Mn, Cd, Zn, Cu) in purple rice and purple rice stems cultivated organically using biogas slug in Padang Pariaman, West Sumatra Province IOP Conference Series: Earth and Environmental Science 709 (1), 012071, 2021 7 2021
152 Google Scholar Authors : IK Budaraga, RA Salihat The effect of material amount in distillation tank to chemical composition of citronella oil (Cymbopogon nardus L. Rendle) IOP Conference Series: Earth and Environmental Science 653 (1), 012043, 2021 4 2021
153 Google Scholar Authors : IK Budaraga, D Pramana Putra, Y Yanti Antimicrobial Activity and Liquid Smoke Minimum Kill Concentration of Cocoa Shell on the Growth of the Lasiodiplodia Theobromae Fungi 0 2021
154 Google Scholar Authors : IK Budaraga, RA Salihat Heavy metals analysis (Cd, Pb, Zn, Cu, Cr) and calcium in Padang and Padang Panjang fresh cow’s milk 3 2021
155 Google Scholar Authors : IK Budaraga, F Maidija Pengabdian kepada Masyarakat Peningkatan Kualitas Kopi Solok Radjo Prosiding Seminar Nasional Pengabdian Kepada Masyarakat 1 (1), 181-190, 2021 4 2021
156 Google Scholar Authors : S Wilanda, N Yessirita, IK Budaraga Kajian Mutu Dan Aktivitas Antioksidan Teh Kulit Kopi (Coffeacanephora) Dengan Penambahan Daun Mint (Mentha Piperita L) Jurnal Research Ilmu Pertanian 1 (1), 76-83, 2021 14 2021
157 Google Scholar Authors : S Wilanda, N Yessirita, IK Budaraga KAJIAN MUTU DAN AKTIVITAS ANTIOKSIDAN TEH KULIT KOPI (Coffea Canephora) DENGAN PENAMBAHAN DAUN MINT Jurnal Research Ilmu Pertanian 1 (1), 86-93, 2021 7 2021
158 Google Scholar Authors : IK Budaraga, N Yulita, N Yessirita Antibacterial study of cocoa skin liquid smoke in raw milk IOP Conference Series: Earth and Environmental Science 803 (1), 012034, 2021 5 2021
159 Google Scholar Authors : IK Budaraga, S Susilawati Sosialisasi Kepada Masyarakat Peningkatan Kualitas Olahan Ikan Maco Di Ukm “Rodi Maco” Seminar nasional pengabdian kepada masyarakat (SNPKM), 1-5, 2021 0 2021
160 Google Scholar Authors : D Syukriani, Ramaiyulis, Nilawati, E Yulia, IK Budaraga Potential and development of incubation technology to improve the quality of" dadih" as a specific food of minangkabau. 0 2021
161 Google Scholar Authors : IMP Bungsu, IK Budaraga, N Yessirita Pengaruh penambahan serbuk jahe merah (Zingiber officinale Var. rubrum) terhadap teh hasil kempaan daun gambir (Uncaria gambir Roxb) Jurnal Research Ilmu Pertanian 1 (2), 110-119, 2021 7 2021
162 Google Scholar Authors : IK Budaraga, S Susilawati Sosialisasi Kepada Masyarakat Peningkatan Kualitas Olahan Ikan Maco Di Ukm “Rodi Maco” Seminar nasional pengabdian kepada masyarakat (SNPKM), 1-5, 2021 0 2021
163 Google Scholar Authors : IK Budaraga, RA Salihat Heavy metals analysis (Cd, Pb, Zn, Cu, Cr) and calcium in Padang and Padang Panjang fresh cow’s milk 3 2021
164 Google Scholar Authors : IK Budaraga, RA Salihat The effect of material amount in distillation tank to chemical composition of citronella oil (Cymbopogon nardus L. Rendle) IOP Conference Series: Earth and Environmental Science 653 (1), 012043, 2021 4 2021
165 Google Scholar Authors : IK Budaraga, RA Salihat Heavy metals analysis (Cd, Pb, Zn, Cu, Cr) and calcium in Padang and Padang Panjang fresh cow’s milk 3 2021
166 Google Scholar Authors : IK Budaraga, DP Putra Test liquid smoke toxicity for cocoa skin [Theobroma Cacao L.] with the BSLT method at different pyrolysis temperatures IOP Conference Series: Earth and Environmental Science 741 (1), 012011, 2021 3 2021
167 Google Scholar Authors : IK Budaraga, DP Putra Study of Green Tea Catechin Dipped with Moringa Leaves IOP Conference Series: Earth and Environmental Science 515 (1), 012027, 2020 2 2020
168 Google Scholar Authors : I Ketut Budaraga, DP Putra Study of the physical properties of liquid smoke from cocoa rind on moisture content and different pyrolysis temperature IOP Conference Series: Earth and Environmental Science 542 (1), 012045, 2020 2 2020
169 Google Scholar Authors : IK Budaraga, R Ramaiyulis Study of Escherichia Coli and Salmonella Sp. Bacterial Contamination from Meatball Seller on Bandar Buat Market in Padang City International Conference on Global Education IX 1 (1), 425-433, 2020 0 2020
170 Google Scholar Authors : IK Budaraga, DP Putra Characteristics of the liquid chemical properties of cocoa skin [Theobroma cacao L.] in different water levels IOP Conference Series: Earth and Environmental Science 497 (1), 012016, 2020 2 2020
171 Google Scholar Authors : IK Budaraga, RA Salihat Antioxidant Activity of â Broken Skinâ Purple Rice, â Skinnedâ Purple Rice, and Purple Rice Stem Organically Cultivated in Indonesia 0 2020
172 Google Scholar Authors : I Ketut Budaraga, DP Putra Study of the physical properties of liquid smoke from cocoa rind on moisture content and different pyrolysis temperature IOP Conference Series: Earth and Environmental Science 542 (1), 012045, 2020 2 2020
173 Google Scholar Authors : IK Budaraga, DP Putra Study of Green Tea Catechin Dipped with Moringa Leaves IOP Conference Series: Earth and Environmental Science 515 (1), 012027, 2020 2 2020
174 Google Scholar Authors : IK Budaraga, RA Salihat Antioxidant activity of ‘broken skin’purple rice,‘skinned’purple rice, and purple rice stem organically cultivated in Indonesia International Journal on Advanced Science, Engineering and Information …, 2020 6 2020
175 Google Scholar Authors : IK Budaraga, DP Putra Characteristics of the liquid chemical properties of cocoa skin [Theobroma cacao L.] in different water levels IOP Conference Series: Earth and Environmental Science 497 (1), 012016, 2020 2 2020
176 Google Scholar Authors : IK Budaraga, R Ramaiyulis Study of Escherichia Coli and Salmonella Sp. Bacterial Contamination from Meatball Seller on Bandar Buat Market in Padang City International Conference on Global Education IX 1 (1), 425-433, 2020 0 2020
177 Google Scholar Authors : IK Budaraga, D Pramana Putra, W Wellyalina Antibacterial activity of moringa leaf layer cake against S. aureus and E. coli Journal of Applied Agricultural Science and Technology 4 (1), 694-708, 2020 8 2020
178 Google Scholar Authors : IK Budaraga, DP Putra Study of Antioxidant Liquid Smoke Cacao Fruit Peel Waste at Different Water Content and Pyrolysis Temperatures 0 2020
179 Google Scholar Authors : IK Budaraga, DP Putra Characteristics of the liquid chemical properties of cocoa skin [Theobroma cacao L.] in different water levels IOP Conference Series: Earth and Environmental Science 497 (1), 012016, 2020 2 2020
180 Google Scholar Authors : C Wulandari, IK Budaraga, W Williyana, L Napassawan Proximate Test and Organoleptik Test on The Characteristics of the moringa Layer Cake Andalasian International Journal of Agricultural and Natural Sciences 1 (01 …, 2020 6 2020
181 Google Scholar Authors : IK Budaraga, RA Salihat Antioxidant activity of ‘broken skin’purple rice,‘skinned’purple rice, and purple rice stem organically cultivated in Indonesia International Journal on Advanced Science, Engineering and Information …, 2020 7 2020
182 Google Scholar Authors : IK Budaraga, RA Salihat Antioxidant Activity of â Broken Skinâ Purple Rice, â Skinnedâ Purple Rice, and Purple Rice Stem Organically Cultivated in Indonesia 0 2020
183 Google Scholar Authors : I Ketut Budaraga, DP Putra Study of the physical properties of liquid smoke from cocoa rind on moisture content and different pyrolysis temperature IOP Conference Series: Earth and Environmental Science 542 (1), 012045, 2020 2 2020
184 Google Scholar Authors : IK Budaraga, DP Putra Study of Green Tea Catechin Dipped with Moringa Leaves IOP Conference Series: Earth and Environmental Science 515 (1), 012027, 2020 2 2020
185 Google Scholar Authors : IK Budaraga, DP Putra Characteristics of the liquid chemical properties of cocoa skin [Theobroma cacao L.] in different water levels IOP Conference Series: Earth and Environmental Science 497 (1), 012016, 2020 2 2020
186 Google Scholar Authors : IK Budaraga, RA Salihat Antioxidant activity of ‘broken skin’purple rice,‘skinned’purple rice, and purple rice stem organically cultivated in Indonesia International Journal on Advanced Science, Engineering and Information …, 2020 6 2020
187 Google Scholar Authors : IK Budaraga, R Ramaiyulis Study of Escherichia Coli and Salmonella Sp. Bacterial Contamination from Meatball Seller on Bandar Buat Market in Padang City International Conference on Global Education IX 1 (1), 425-433, 2020 0 2020
188 Google Scholar Authors : IK Budaraga, EA Murnita Penyuluhan Manfaat Penerapan Pertanian Organik Di Kelompok Tani Kampung Apar Nagari Se Buluh Kecamatan Batang Anai Kabupaten Padang Pariaman Seminar Nasional Sosial Ekonomi 2019, 93, 2019 1 2019
189 Google Scholar Authors : IK Budaraga, DP Putra Liquid smoke antimicrobial test of cocoa fruit peel against eschericia coli and staphylococcus aureus bacteria IOP Conference Series: Earth and Environmental Science 365 (1), 012049, 2019 19 2019
190 Google Scholar Authors : A Ananto Models and Techniques of Automatic Humidity Temperature setting on Oyster Mushrooms using Digital Skylite International Journal of ChemTech Research 12 (6), 71-75, 2019 0 2019
191 Google Scholar Authors : IK Budaraga Karakteristik Asap Cair Kulit Kakao (Theobroma Cacao, l) Pada Air Yang Berbeda UNES JOURNAL MAHASISWA PERTANIAN 3 (1), 011-019, 2019 0 2019
192 Google Scholar Authors : A Ananto Models and Techniques of Automatic Humidity Temperature setting on Oyster Mushrooms using Digital Skylite International Journal of ChemTech Research 12 (6), 71-75, 2019 0 2019
193 Google Scholar Authors : IK Budaraga Buku manual Cara Pembuatan Asap Cair dari Buah Kakao dan Aplikasi Sebagai Pestisida Tanaman Kakao 0 2019
194 Google Scholar Authors : IK Budaraga Buku Manual Cara Pembuatan Asap Cair Dari Buah Kulit Kakao Dan Aplikasi Sebagai Pestisida Alami Pada Tanaman Kakao 0 2019
195 Google Scholar Authors : IK Budaraga, E Susanti, A Asnurita, E Nurdin, R Ramaiyulis The antioxidant characteristics of the liquid smoke of cocoa shell (Theobroma cacao, L) in different water content variations Journal of Applied Agricultural Science and Technology 3 (2), 226-238, 2019 10 2019
196 Google Scholar Authors : IK Budaraga, E Susanti Study of Toxicity of Cacao Skin Liquid (Theobroma cacao, L) Using BSLT Method (Brine Shrimp Lethality Test) International Journal of ChemTech Research 12 (5), 8-17, 2019 0 2019
197 Google Scholar Authors : IK Budaraga, E Susanti Study of Toxicity of Cacao Skin Liquid (Theobroma cacao, L) Using BSLT Method (Brine Shrimp Lethality Test) International Journal of ChemTech Research 12 (5), 8-17, 2019 0 2019
198 Google Scholar Authors : IK Budaraga, DP Putra Liquid smoke antimicrobial test of cocoa fruit peel against eschericia coli and staphylococcus aureus bacteria IOP Conference Series: Earth and Environmental Science 365 (1), 012049, 2019 19 2019
199 Google Scholar Authors : IK Budaraga, Tukiran, Syamsuwirman Influence of Liquid Smoke Cinnamon Against Attacks Leaf Rot Disease (Phytophthora Infestans) on Potato (Solanum Tuberosum L.) IOP Conference Series: Earth and Environmental Science 347 (1), 012036, 2019 4 2019
200 Google Scholar Authors : IK Budaraga, R Ramaiyulis, E Nurdin, R Rauf Penyuluhan Jajanan, Makanan dan Kantin Sehat di Sekolah SMA 2 Batang Anai Kecamatan Batang Anai Kabupaten Padang Pariaman Buletin Udayana Mengabdi 18 (3), 61-67, 2019 11 2019
201 Google Scholar Authors : IK Budaraga, Tukiran, Syamsuwirman Influence of Liquid Smoke Cinnamon Against Attacks Leaf Rot Disease (Phytophthora Infestans) on Potato (Solanum Tuberosum L.) IOP Conference Series: Earth and Environmental Science 347 (1), 012036, 2019 4 2019
202 Google Scholar Authors : IK Budaraga, E Susanti, A Asnurita, E Nurdin, R Ramaiyulis The antioxidant characteristics of the liquid smoke of cocoa shell (Theobroma cacao, L) in different water content variations Journal of Applied Agricultural Science and Technology 3 (2), 226-238, 2019 10 2019
203 Google Scholar Authors : IK Budaraga, Tukiran, Syamsuwirman Influence of Liquid Smoke Cinnamon Against Attacks Leaf Rot Disease (Phytophthora Infestans) on Potato (Solanum Tuberosum L.) IOP Conference Series: Earth and Environmental Science 347 (1), 012036, 2019 4 2019
204 Google Scholar Authors : IK Budaraga, R Ramaiyulis, E Susanti, A Asnurita, E Nurdin The antioxidant characteristics of the liquid smoke of cocoa shell (Theobroma cacao, L) in different water content variations Journal of Applied Agricultural Science and Technology 3 (2), 226-238, 2019 10 2019
205 Google Scholar Authors : IK Budaraga Karakteristik Asap Cair Kulit Kakao (Theobroma Cacao, l) Pada Air Yang Berbeda UNES JOURNAL MAHASISWA PERTANIAN 3 (1), 011-019, 2019 0 2019
206 Google Scholar Authors : IK Budaraga Karakteristik Asap Cair Kulit Kakao (Theobroma Cacao, l) Pada Air Yang Berbeda UNES JOURNAL MAHASISWA PERTANIAN 3 (1), 011-019, 2019 0 2019
207 Google Scholar Authors : IK Budaraga, E Susanti Study of Toxicity of Cacao Skin Liquid (Theobroma cacao, L) Using BSLT Method (Brine Shrimp Lethality Test) International Journal of ChemTech Research 12 (5), 8-17, 2019 0 2019
208 Google Scholar Authors : IK Budaraga Buku manual Cara Pembuatan Asap Cair dari Buah Kakao dan Aplikasi Sebagai Pestisida Tanaman Kakao 0 2019
209 Google Scholar Authors : IK Budaraga Buku Manual Cara Pembuatan Asap Cair Dari Buah Kulit Kakao Dan Aplikasi Sebagai Pestisida Alami Pada Tanaman Kakao 0 2019
210 Google Scholar Authors : IK Budaraga Study of Antioxidant Liquid Smoke Cacao Fruit Peel Waste at Different Water Content and Pyrolysis Temperatures 1 2019
211 Google Scholar Authors : IK Budaraga, Tukiran, Syamsuwirman Influence of Liquid Smoke Cinnamon Against Attacks Leaf Rot Disease (Phytophthora Infestans) on Potato (Solanum Tuberosum L.) IOP Conference Series: Earth and Environmental Science 347 (1), 012036, 2019 4 2019
212 Google Scholar Authors : IK Budaraga, S Wahyuni, A Asnurita Characteristics of Physical and Chemical of Cocoa Skin Liquid Smoke (Treoboma Cacao L.) on different Moisture Content 0 2018
213 Google Scholar Authors : IK Budaraga Effect Of Combination Treatment Of Concentration Liquid Smoke, Immersion Duration, Packaging And Old Type Storage Different Levels Of Fiber And Ash Fish Tilapia Fillet … International Journal of ChemTech Research 11 (No.08), 347-365 2 2018
214 Google Scholar Authors : IK Budaraga Disertasi:Potensi Asap Cair Dari Berbagai Sumber Dan Aplikasinya Sebagai Pengawet Fillet Ikan Nila (Oreochromis Nilotica) 0 2018
215 Google Scholar Authors : IK Budaraga The Effect of Combination of Liquid SmokeTo Degrees of Material (PH) Fillet Fish Tilapia International Journal of ChemTech Research 11 (2), 207-218, 2018 1 2018
216 Google Scholar Authors : IK Budaraga Effect of Combination Treatment of Concentration Liquid Smoke, Immersion Duration. Packaging and Old Type Storage different Levels of Fat Fish Tilapia Fillet (Oreochromis … International Journal of ChemTech Research 11 (02), 244-254, 2018 3 2018
217 Google Scholar Authors : IK Budaraga The Effect of Combination of Liquid SmokeTo Degrees of Material (PH) Fillet Fish Tilapia International Journal of ChemTech Research 11 (2), 207-218, 2018 1 2018
218 Google Scholar Authors : IK Budaraga Effect of Combination Treatment Of Concentration Liquid Smoke, Immersion Duration, Packaging And Old Type Storage Different Levels Of Phenol And Carbonil Nila Fish Fillet … International Journal of ChemTech Research 11 (08), 364-380 2 2018
219 Google Scholar Authors : IK Budaraga Liquid Smoke Toxicity With Variation Of Temperature And Concentration 0 2018
220 Google Scholar Authors : IK Budaraga Kajian Mutu Minuman Segar Corens Dengan Penggunaan Berbagai Jenis Jeruk 0 2018
221 Google Scholar Authors : IK Budaraga, S Wahyuni, A Asnurita Characteristics of Physical and Chemical of Cocoa Skin Liquid Smoke (Treoboma Cacao L.) on different Moisture Content 0 2018
222 Google Scholar Authors : IK Budaraga Effect of Combination Treatment of Concentration Liquid Smoke, Immersion Duration. Packaging and Old Type Storage different Levels of Fat Fish Tilapia Fillet (Or... International Journal of ChemTech Research 11 (02), 244-254 1 2018
223 Google Scholar Authors : IK Budaraga Effect of Combination Treatment Of Concentration Liquid Smoke, Immersion Duration, Packaging And Old Type Storage Different Levels Of Phenol And Carbonil Nila Fish Fillet … International Journal of ChemTech Research 11 (08), 364-380, 2018 3 2018
224 Google Scholar Authors : IK Budaraga Effect Of Combination Treatment Of Concentration Liquid Smoke, Immersion Duration, Packaging And Old Type Storage Different Levels Of Fiber And Ash Fish Tilapia Fillet … International Journal of ChemTech Research 11 (No.08), 347-365 2 2018
225 Google Scholar Authors : IK Budaraga Disertasi:Potensi Asap Cair Dari Berbagai Sumber Dan Aplikasinya Sebagai Pengawet Fillet Ikan Nila (Oreochromis Nilotica) 0 2018
226 Google Scholar Authors : IK Budaraga The Effect of Combination of Liquid SmokeTo Degrees of Material (PH) Fillet Fish Tilapia International Journal of ChemTech Research 11 (2), 207-218, 2018 1 2018
227 Google Scholar Authors : IK Budaraga The Effect of Combination of Liquid SmokeTo Degrees of Material (PH) Fillet Fish Tilapia International Journal of ChemTech Research 11 (2), 207-218, 2018 1 2018
228 Google Scholar Authors : IK Budaraga Effect of Combination Treatment of Concentration Liquid Smoke, Immersion Duration. Packaging and Old Type Storage different Levels of Fat Fish Tilapia Fillet (Oreochromis … International Journal of ChemTech Research 11 (02), 244-254, 2018 3 2018
229 Google Scholar Authors : IK Budaraga Effect of Combination Treatment Of Concentration Liquid Smoke, Immersion Duration, Packaging And Old Type Storage Different Levels Of Phenol And Carbonil Nila Fish Fillet … International Journal of ChemTech Research 11 (08), 364-380 2 2018
230 Google Scholar Authors : IK Budaraga, S Wahyuni, A Asnurita Characteristics of Physical and Chemical of Cocoa Skin Liquid Smoke (Treoboma Cacao L.) on different Moisture Content 0 2018
231 Google Scholar Authors : G Gusriati, A Armia, IK Budaraga ESTABLISHING ORGANIC RICE PRODUCTION: TECHNICAL, ECONOMIC AND SOCIAL CONSTRAINTS (Case Study on Organic Farmers in Nagari Sariek Alahan Tigo, Hiliran Gumanti Sub-District … UNES Journal of Agricultural Scienties 1 (2), 167-175, 2017 0 2017
232 Google Scholar Authors : IK Budaraga Effect of Combination Treatment of Liquid Smoke Concentration, Soaking Time, Packaging and Different Storage Time To Yield And Moisture Contentnila Fish Fillet (Oreochromis … International Journal of ChemTech Research 10 (Vol.10 No.1 pp 77-88, 2017 … 0 2017
233 Google Scholar Authors : IK Budaraga, Y Oktavia, L Hermalena Study of the Quality chemical of Fresh Drinks Corens with the Use of Different Types of Oranges Journal of PharmTech Research 9 (6), 2017 0 2017
234 Google Scholar Authors : IK Budaraga Effect of Combination Treatment of Concentration Liquid Smoke, Immersion Duration, Packaging and Long Storage different Levels of Antibacterials Nila Fish Fillet (Oreochromis … International Journal of ChemTech Research 10 (15), 317-331, 2017 0 2017
235 Google Scholar Authors : IK Budaraga Effect of Combination Treatment of Concentration Liquid Smoke, Immersion Duration, Packaging and Long Storage different Levels of Antibacterials Nila Fish Fillet (... International Journal of ChemTech Research 10 (no.15), 317-331 1 2017
236 Google Scholar Authors : Y Oktavia, IK Budaraga, L Hermalena KAJIAN MUTU MINUMAN SEGAR CORENS DENGAN PENGGUNAAN BERBAGAI JENIS JERUK UNES JOURNAL MAHASISWA PERTANIAN 1 (1), 009-020, 2017 0 2017
237 Google Scholar Authors : IK Budaraga, R Ramaiyulis, E Nurdin Vegetable Cultivation Hydroponics System In Community Economic Zone (KEM) Kanagarian Tikalak Subdistrict X Koto Singkarak Districts Solok INTERNATIONAL JOURNAL OF SCIENTIFIC & TECHNOLOGY RESEARCH 6 (5), 29-34, 2017 1 2017
238 Google Scholar Authors : IK Budaraga Effect of Combination Treatment of Liquid Smoke Concentration, Soaking Time, Packaging and Different Storage Time To Yield And Moisture Content nila Fish Fillet (Oreochromis … International Journal of ChemTech Research 10 (1), 77-88, 2017 2 2017
239 Google Scholar Authors : S Maria, IK Budaraga, L Hermalena Pendugaan Umur Simpan Minuman Corens Dengan Metode Arrhenius UNES Journal Mahasiswa Pertanian 1 (1), 034-042, 2017 1 2017
240 Google Scholar Authors : IK Budaraga Effect of Combination Treatment of Concentration Liquid Smoke, Immersion Duration, Packaging and Long Storage different Levels of Antioxidant Tilapia Fish Fillet (Oreochromis … International Journal of ChemTech Research 10 (nomor 15), 332-343 2 2017
241 Google Scholar Authors : IK Budaraga Processing taro tubers (Colocasia esculenta (L) Schott) become flour as efforts to increase community revenues in Mentawai region Journal of Life Sciences Research 5 (2), 62-70, 2017 5 2017
242 Google Scholar Authors : IK Budaraga Processing taro tubers (Colocasia esculenta (L) Schott) become flour as efforts to increase community revenues in Mentawai region Journal of Life Sciences Research 5 (2), 62-70, 2017 5 2017
243 Google Scholar Authors : IK Budaraga, UB Arnim, Yetti Marlida Liquid Smoke Toxicity Properties of Production of Raw Materials With Variation of Temperature and Concentration of Different International Journal of PharmTech Research 9 (10), 10, 2017 9 2017
244 Google Scholar Authors : IK Budaraga Effect of Combination Treatment of Concentration Liquid Smoke, Immersion Duration, Packaging and Long Storage different Levels of Antibacterials Nila Fish Fillet (... International Journal of ChemTech Research 10 (no.15), 317-331 1 2017
245 Google Scholar Authors : G Gusriati, A Armia, IK Budaraga ESTABLISHING ORGANIC RICE PRODUCTION: TECHNICAL, ECONOMIC AND SOCIAL CONSTRAINTS (Case Study on Organic Farmers in Nagari Sariek Alahan Tigo, Hiliran Gumanti Sub-District … UNES Journal of Agricultural Scienties 1 (2), 167-175, 2017 0 2017
246 Google Scholar Authors : IK Budaraga, R Ramaiyulis, E Nurdin Vegetable Cultivation Hydroponics System In Community Economic Zone (KEM) Kanagarian Tikalak Subdistrict X Koto Singkarak Districts Solok INTERNATIONAL JOURNAL OF SCIENTIFIC & TECHNOLOGY RESEARCH 6 (5), 29-34, 2017 1 2017
247 Google Scholar Authors : IK Budaraga, R Ramaiyulis, E Nurdin Vegetable Cultivation Hydroponics System In Community Economic Zone (KEM) Kanagarian Tikalak Subdistrict X Koto Singkarak Districts Solok Journal of Scientific and Technology Research 6 (5), 29-34, 2017 1 2017
248 Google Scholar Authors : S Maria, IK Budaraga, L Hermalena Pendugaan Umur Simpan Minuman Corens Dengan Metode Arrhenius UNES Journal Mahasiswa Pertanian 1 (1), 034-042, 2017 1 2017
249 Google Scholar Authors : G Gusriati, A Armia, IK Budaraga ESTABLISHING ORGANIC RICE PRODUCTION: TECHNICAL, ECONOMIC AND SOCIAL CONSTRAINTS (Case Study on Organic Farmers in Nagari Sariek Alahan Tigo, Hiliran Gumanti Sub-District … UNES Journal of Agricultural Scienties 1 (2), 167-175, 2017 0 2017
250 Google Scholar Authors : IK Budaraga Effect of Combination Treatment of Liquid Smoke Concentration, Soaking Time, Packaging and Different Storage Time To Yield And Moisture Contentnila Fish Fillet (Oreochromis … International Journal of ChemTech Research 10 (Vol.10 No.1 pp 77-88, 2017 … 0 2017
251 Google Scholar Authors : IK Budaraga Effect of Combination Treatment of Concentration Liquid Smoke, Immersion Duration, Packaging and Long Storage different Levels of Antibacterials Nila Fish Fillet International Journal of ChemTech Research 10 (15), 317-331, 2017 0 2017
252 Google Scholar Authors : IK Budaraga PENGABDIAN KEPADA MASYARAKAT PEMBUATAN RAMUAN ORGANIK TANAMAN (ROTAN) DIKAWASAN EKONOMI MASYARAKAT (KEM) KANAGARIAN TIKA... UNES Journal of Community Service 2 (2), 127-134 0 2017
253 Google Scholar Authors : IK Budaraga Effect of Combination Treatment of Concentration Liquid Smoke, Immertion Duration, Packaging and old Type Storage different Levels of Protein Nila Fish Fillet (Oreochromis … Journal of ChemTech Research 10 (3), 1-10, 2017 5 2017
254 Google Scholar Authors : IK Budaraga, UB Arnim, Yetti Marlida Liquid Smoke Toxicity Properties of Production of Raw Materials With Variation of Temperature and Concentration of Different International Journal of PharmTech Research 9 (10), 10, 2017 9 2017
255 Google Scholar Authors : IK Budaraga Penyuluhan Pemanfaatan Asap Cair Kulit Kakao Sebagai Pestisida Alami Pada Tanaman Kakao Di Kelompok Tani Aulia Natural Di Kabupaten Padang Pariaman 0 2017
256 Google Scholar Authors : IK Budaraga Antibacterial Properties of Liquid Smoke from Various Raw Materials with Different Pyrolysis Temperature Level International Journal of ChemTech Research 10 (5), 31-45, 2017 1 2017
257 Google Scholar Authors : IK Budaraga Effect of Combination Treatment of Concentration Liquid Smoke, Immertion Duration, Packaging and old Type Storagedifferent Levels of Protein Nila Fish Fillet (Ore... International Journal of ChemTech Research, 01-10 1 2017
258 Google Scholar Authors : IK Budaraga Processing taro tubers (Colocasia esculenta (L) Schott) become flour as efforts to increase community revenues in Mentawai region Journal of Life Sciences Research 5 (2), 62-70, 2017 5 2017
259 Google Scholar Authors : IK Budaraga Effect of Combination Treatment of Liquid Smoke Concentration, Soaking Time, Packaging and Different Storage Time To Yield And Moisture Contentnila Fish Fillet (Oreochromis … International Journal of ChemTech Research 10 (Vol.10 No.1 pp 77-88, 2017 … 0 2017
260 Google Scholar Authors : Y Oktavia, IK Budaraga, L Hermalena KAJIAN MUTU MINUMAN SEGAR CORENS DENGAN PENGGUNAAN BERBAGAI JENIS JERUK UNES JOURNAL MAHASISWA PERTANIAN 1 (1), 009-020, 2017 0 2017
261 Google Scholar Authors : IK Budaraga, UB Arnim, Yetti Marlida Liquid Smoke Toxicity Properties of Production of Raw Materials With Variation of Temperature and Concentration of Different International Journal of PharmTech Research 9 (10), 10, 2017 9 2017
262 Google Scholar Authors : IK Budaraga Effect of Combination Treatment of Liquid Smoke Concentration, Soaking Time, Packaging and Different Storage Time To Yield And Moisture Contentnila Fish Fillet (Oreochromis … International Journal of ChemTech Research 10 (Vol.10 No.1 pp 77-88, 2017 … 0 2017
263 Google Scholar Authors : IK Budaraga Effect of Combination Treatment of Concentration Liquid Smoke, Immersion Duration, Packaging and Long Storage different Levels of Antibacterials Nila Fish Fillet (... International Journal of ChemTech Research 10 (no.15), 317-331 1 2017
264 Google Scholar Authors : Y Oktavia, IK Budaraga, L Hermalena KAJIAN MUTU MINUMAN SEGAR CORENS DENGAN PENGGUNAAN BERBAGAI JENIS JERUK UNES JOURNAL MAHASISWA PERTANIAN 1 (1), 009-020, 2017 0 2017
265 Google Scholar Authors : IK Budaraga, R Ramaiyulis, E Nurdin Vegetable Cultivation Hydroponics System In Community Economic Zone (KEM) Kanagarian Tikalak Subdistrict X Koto Singkarak Districts Solok INTERNATIONAL JOURNAL OF SCIENTIFIC & TECHNOLOGY RESEARCH 6 (5), 29-34, 2017 1 2017
266 Google Scholar Authors : IK Budaraga Effect of Combination Treatment of Liquid Smoke Concentration, Soaking Time, Packaging and Different Storage Time To Yield And Moisture Content nila Fish Fillet (Oreochromis … International Journal of ChemTech Research 10 (1), 77-88, 2017 2 2017
267 Google Scholar Authors : S Maria, IK Budaraga, L Hermalena Pendugaan Umur Simpan Minuman Corens Dengan Metode Arrhenius UNES Journal Mahasiswa Pertanian 1 (1), 034-042, 2017 1 2017
268 Google Scholar Authors : G Gusriati, A Armia, IK Budaraga ESTABLISHING ORGANIC RICE PRODUCTION: TECHNICAL, ECONOMIC AND SOCIAL CONSTRAINTS (Case Study on Organic Farmers in Nagari Sariek Alahan Tigo, Hiliran Gumanti Sub-District … UNES Journal of Agricultural Scienties 1 (2), 167-175, 2017 0 2017
269 Google Scholar Authors : IK Budaraga MEMBANGUN PRODUKSI PADI ORGANIK: KENDALA TEKNIS, EKONOMIS DAN SOSIAL UNES JOURNAL OF AGRICULTURAL SCIENTIES 1 (2), 167-175, 2017 0 2017
270 Google Scholar Authors : S Syamsuwirman, IK Budaraga, T Tukiran PENGARUH PENGGUNAAN ASAP CAIR TERHADAP SERANGAN PENYAKIT BUSUK DAUN (Phytophthora infestans) PADA KENTANG (Solanum tuberasum L.) UNES Journal of Scientech Research 2 (2), 218-228, 2017 0 2017
271 Google Scholar Authors : IK Budaraga Effect of Combination Treatment of Liquid Smoke Concentration, Soaking Time, Packaging and Different Storage Time To Yield And Moisture Content nila Fish Fillet (Oreochromis … International Journal of ChemTech Research 10 (1), 77-88, 2017 1 2017
272 Google Scholar Authors : S Syamsuwirman, IK Budaraga, T Tukiran EFFECT OF GRANTING FEED OF NPK FERTILIZER FERTILIZER TO GROWTH AND RESULT CAISIM PLANT (Brassica Juncea L) UNES Journal Of Scientech research 2 (2), 218-228, 2017 0 2017
273 Google Scholar Authors : IK Budaraga Effect of Combination Treatment of Concentration Liquid Smoke, Immertion Duration, Packaging and old Type Storagedifferent Levels of Protein Nila Fish Fillet (Oreochromis niloticus) International Journal of ChemTech Research, 01-10 0 2017
274 Google Scholar Authors : IK Budaraga MEMBANGUN PRODUKSI PADI ORGANIK: KENDALA TEKNIS, EKONOMIS DAN SOSIAL UNES JOURNAL OF AGRICULTURAL SCIENTIES 1 (2), 167-175, 2017 0 2017
275 Google Scholar Authors : IK Budaraga PENGABDIAN KEPADA MASYARAKAT PEMBUATAN RAMUAN ORGANIK TANAMAN (ROTAN) DIKAWASAN EKONOMI MASYARAKAT (KEM) KANAGARIAN TIKA... UNES Journal of Community Service 2 (2), 127-134 0 2017
276 Google Scholar Authors : IK Budaraga Effect of Combination Treatment of Concentration Liquid Smoke, Immertion Duration, Packaging and old Type Storage different Levels of Protein Nila Fish Fillet (Oreochromis … Journal of ChemTech Research 10 (3), 1-10, 2017 5 2017
277 Google Scholar Authors : IK Budaraga Effect of Combination Treatment of Concentration Liquid Smoke, Immertion Duration, Packaging and old Type Storage different Levels of Protein Nila Fish Fillet (Oreochromis … Journal of ChemTech Research 10 (3), 1-10, 2017 5 2017
278 Google Scholar Authors : IK Budaraga Effect of Combination Treatment of Concentration Liquid Smoke, Immersion Duration, Packaging and Long Storage different Levels of Antibacterials Nila Fish Fillet (Oreochromis … International Journal of ChemTech Research 10 (no.15), 317-331 2 2017
279 Google Scholar Authors : S Syamsuwirman, IK Budaraga, T Tukiran EFFECT OF GRANTING FEED OF NPK FERTILIZER FERTILIZER TO GROWTH AND RESULT CAISIM PLANT (Brassica Juncea L) UNES Journal Of Scientech research 2 (2), 218-228, 2017 0 2017
280 Google Scholar Authors : IK Budaraga, A Arnim, Y Marlinda, U Bulain Chemical Components Analysis of Cinnamon Liquid Smoke with GC MS from Various Production of different Purification Method International Journal of ChemTech Research 10 (1), 12-26, 2017 9 2017
281 Google Scholar Authors : G Gusriati, A Armia, IK Budaraga ESTABLISHING ORGANIC RICE PRODUCTION: TECHNICAL, ECONOMIC AND SOCIAL CONSTRAINTS (Case Study on Organic Farmers in Nagari Sariek Alahan Tigo, Hiliran Gumanti Sub-District … UNES Journal of Agricultural Scienties 1 (2), 167-175 0 2017
282 Google Scholar Authors : IK Budaraga Pengabdian Kepada Masyarakat Pembuatan Ramuan Organik Hama Dikawasan Ekonomi Masyarakat (KEM) Tikalak Kecamatan X Koto Singkarak Kabupaten Solok 0 2017
283 Google Scholar Authors : IK Budaraga PENGABDIAN KEPADA MASYARAKAT PEMBUATAN RAMUAN ORGANIK TANAMAN (ROTAN) DIKAWASAN EKONOMI MASYARAKAT (KEM) KANAGARIAN TIKALAK KECAMATAN X KOTO SINGKARAK KABUPATEN SOLOK UNES Journal of Community Service 2 (2), 127-134, 2017 0 2017
284 Google Scholar Authors : IK Budaraga Effect of Combination Treatment of Concentration Liquid Smoke, Immersion Duration, Packaging and Long Storage different Levels of Antibacterials Nila Fish Fillet (Oreochromis … International Journal of ChemTech Research 10 (15), 317-331, 2017 0 2017
285 Google Scholar Authors : IK Budaraga Effect of Combination Treatment of Concentration Liquid Smoke, Immersion Duration, Packaging and Long Storage different Levels of Antioxidant Tilapia Fish Fillet (... International Journal of ChemTech Research 10 (nomor 15), 332-343 1 2017
286 Google Scholar Authors : IK Budaraga Antibacterial Properties of Liquid Smoke from Various Raw Materials with Different Pyrolysis Temperature Level International Journal of ChemTech Research 10 (5), 31-45, 2017 1 2017
287 Google Scholar Authors : IK Budaraga MEMBANGUN PRODUKSI PADI ORGANIK: KENDALA TEKNIS, EKONOMIS DAN SOSIAL UNES JOURNAL OF AGRICULTURAL SCIENTIES 1 (2), 167-175, 2017 0 2017
288 Google Scholar Authors : IK Budaraga Effect of Combination Treatment of Concentration Liquid Smoke, Immertion Duration, Packaging and old Type Storagedifferent Levels of Protein Nila Fish Fillet (Oreochromis … International Journal of ChemTech Research, 01-10 2 2017
289 Google Scholar Authors : IK Budaraga PENGABDIAN KEPADA MASYARAKAT PEMBUATAN RAMUAN ORGANIK TANAMAN (ROTAN) DIKAWASAN EKONOMI MASYARAKAT (KEM) KANAGARIAN TIKALAK KECAMATAN X KOTO SINGKARAK KABUPATEN SOLOK UNES Journal of Community Service 2 (2), 127-134, 2017 0 2017
290 Google Scholar Authors : YMS Asnurita, IK Budaraga Pengaruh Konsentrasi Starter Acetobacter Xylinum Terhadap Mutu Nata De Cucumber Journal of Agricultural Science Development (JASED) 1 (2), 2017 1 2017
291 Google Scholar Authors : IK Budaraga, A Arnim, Y Marlinda, U Bulain Antioxidant properties of liquid smoke production variation of pyrolysis temperature raw and different concentration Journal of PharmTech Research 9 (6), 366-379, 2016 16 2016
292 Google Scholar Authors : A Aisyah, G Gusriati, IK Budaraga FACTORS WHICH WILL AFFECT THE GROWTH OF THE RUBBER ((Havea brasiliensis) IN THE PROVINCE OF WEST SUMATRA PASAMAN UNES Journal Of Scientech research 1 (1), 65-74, 2016 0 2016
293 Google Scholar Authors : IK Budaraga, Y Marlinda, A Arnim, U Bulain Cattle cow dung use as an alternative energy source and organic fertilizer friendly enviroment village Kasang districts Batang Anai Padang Pariaman Journal of Scientific and Technology Research 5 (9), 159-173, 2016 4 2016
294 Google Scholar Authors : A Aisyah, G Gusriati, IK Budaraga FAKTOR-FAKTOR YANG MEMPENGARUHI PRODUKSI KARET (Havea brasiliensis) DI KABUPATEN PASAMAN PROVINSI SUMATERA BARAT UNES Journal of Scientech Research 1 (1), 065-074, 2016 1 2016
295 Google Scholar Authors : B I Ketut, F Fridarti Pembuatan Pakan Ternak Sapi dari Jerami menggunakan Ramuan Organik Ternak (ROTER) sebagai salah satu perwujudan Kegiatan KKN-PPM Terintegrasi di kanagarian Kasang kecamatan … Seminar Nasional Politekni Pertanian Negeri Payakumbuh 1 (1), 177-isi, 2016 0 2016
296 Google Scholar Authors : IK Budaraga, A Arnim, Y Marlinda, U Bulain Antibacterial Properties of Liquid Smoke from the Production of Cinnamon How Purification and Concentration of Different International Journal of Thesis Projects and Dissertations (IJTPD) 4 (2 …, 2016 10 2016
297 Google Scholar Authors : IK Budaraga, G Gusriati, H Gusvita, Z Zulfitriyana Analysis Of Factors Affecting Demand Red Chili Pepper (Capsicum Annum L) In Solok And Effort Fulfillment International Journal of Scientific & Technology Research 8 (3), 159-173, 2016 13 2016
298 Google Scholar Authors : IK Budaraga Pembuatan Pakan Ternak Sapi Dari Jerami Menggunakan Ramuan Organik Ternak (Roter) Sebagai Salah Satu Perwujudan Kegiatan Kkn-Ppm Pertanian Terintegrasi Di Kanagarian Kasang … 0 2016
299 Google Scholar Authors : IK Budaraga, A Arnim, Y Marlinda, U Bulain Characteristics of cinnamon liquid smoke produced using several purification techniques American Journal of Food Science and Nutrition Research 3 (2), 16-21, 2016 13 2016
300 Google Scholar Authors : IK Budaraga Effect Combination Treatment Different Concentration of Liquid Smoke, Immersion Duration, Packaging and Storage Duration to Organoleptic quality Fillet Tilapia Fish … International Journal of Advanced Scientific and Technical Research 2 (6 …, 2016 2 2016
301 Google Scholar Authors : IK Budaraga Disertasi POTENSI ASAP CAIR DARI BERBAGAI SUMBER DAN APLIKASINYA SEBAGAI PENGAWET FILLET IKAN NILA (Oreochromis nilotica) Ilmu Pertanian program pasca sarjana Universitas Andalas, 2016 0 2016
302 Google Scholar Authors : IK Budaraga Effect Combination Treatment Different Concentration of Liquid Smoke, Immersion Duration, Packaging and Storage Duration to Organoleptic quality Fillet Tilapia Fish … International Journal of Advanced Scientific and Technical Research 2 (6 …, 2016 2 2016
303 Google Scholar Authors : A BudaragaIK, UB YettiMarlida Antioxidant Properties of Liquid Smoke Cinnamon Production of Variation Purification and Different Concentration International Journal of Scientific & Technology Research (IJSTR). ISSN ISSN … 3 2016
304 Google Scholar Authors : IK Budaraga, YM Arnim, B Usman Liquid smoke toxicity characteristic from raw materials variation production with different temperature and concentration level International Journal of Agricultural Technology 12 (6), 1017-1034, 2016 0 2016
305 Google Scholar Authors : IK Budaraga, YM Arnim Usman Bulanin,. 2016. Antioxidant Properties of Liquid Smoke Cinnamon Production of Variation Purification and Different Concentration International Journal of Scientific & Technology Research (IJSTR). ISSN ISSN …, 2016 5 2016
306 Google Scholar Authors : IK Budaraga, F Fridarti Biogas Technology Application As One Of The Realization Of Kkn Ppm Integrated In Agricultural District Kanagarian kasang Batang Anai Padang Pariaman 0 2016
307 Google Scholar Authors : IK Budaraga Study On The Use Of Green Bean As Skim Milk Substitution In Yellow Pumpkin (Cucurbita Maxima) UNES Journal Of Community Service 2 (2), 2016 0 2016
308 Google Scholar Authors : IK Budaraga, A Arnim, Y Marlinda, U Bulain Characteristics of cinnamon liquid smoke produced using several purification techniques American Journal of Food Science and Nutrition Research 3 (2), 16-21, 2016 13 2016
309 Google Scholar Authors : UB I Ketut Budaraga,Arnim,YettiMarlida Effect Combination Treatment Different Concentration of Liquid Smoke, Immersion Duration, Packaging and Storage Duration to Organoleptic quality Fillet Tilapia Fish (Oreochromisniloticus) International Journal of Advanced Scientific and Technical Research Issue 6 ... 0 2016
310 Google Scholar Authors : IK Budaraga Pembuatan Pakan Ternak Sapi Dari Jerami Menggunakan Ramuan Organik Ternak (Roter) Sebagai Salah Satu Perwujudan Kegiatan Kkn-Ppm Pertanian Terintegrasi Di Kanagarian Kasang … 0 2016
311 Google Scholar Authors : IK Budaraga Effect Combination Treatment Different Concentration of Liquid Smoke, Immersion Duration, Packaging and Storage Duration to Organoleptic quality Fillet Tilapia Fish … International Journal of Advanced Scientific and Technical Research 2 (6 …, 2016 3 2016
312 Google Scholar Authors : A Aisyah, G Gusriati, IK Budaraga FAKTOR-FAKTOR YANG MEMPENGARUHI PRODUKSI KARET (Havea brasiliensis) DI KABUPATEN PASAMAN PROVINSI SUMATERA BARAT UNES Journal of Scientech Research 1 (1), 065-074, 2016 1 2016
313 Google Scholar Authors : IK Budaraga, A Arnim, Y Marlinda, U Bulain Analysis of liquid smoke chemical components with GC MS from different raw materials variation production and pyrolysis temperature level International Journal of ChemTech Research 9 (06), 694-708, 2016 47 2016
314 Google Scholar Authors : IK Budaraga Effect Combination Treatment Different Concentration of Liquid Smoke, Immersion Duration, Packaging and Storage Duration to Organoleptic quality Fillet Tilapia Fish … International Journal of Advanced Scientific and Technical Research 2 (6 …, 2016 2 2016
315 Google Scholar Authors : IK Budaraga, A Arnim, Y Marlinda, U Bulain Antibacterial Properties of Liquid Smoke from the Production of Cinnamon How Purification and Concentration of Different International Journal of Thesis Projects and Dissertations (IJTPD) 4 (2 …, 2016 10 2016
316 Google Scholar Authors : IK Budaraga, A Arnim, Y Marlinda, U Bulain Antioxidant properties of liquid smoke production variation of pyrolysis temperature raw and different concentration Journal of PharmTech Research 9 (6), 366-379, 2016 16 2016
317 Google Scholar Authors : IK Budaraga, YM Arnim Usman Bulanin,. 2016. Antioxidant Properties of Liquid Smoke Cinnamon Production of Variation Purification and Different Concentration International Journal of Scientific & Technology Research (IJSTR). ISSN ISSN …, 2016 5 2016
318 Google Scholar Authors : IK Budaraga, F Fridarti Biogas Technology Application As One Of The Realization Of Kkn Ppm Integrated In Agricultural District Kanagarian kasang Batang Anai Padang Pariaman 0 2016
319 Google Scholar Authors : IK Budaraga Study On The Use Of Green Bean As Skim Milk Substitution In Yellow Pumpkin (Cucurbita Maxima) UNES Journal Of Community Service 2 (2), 2016 0 2016
320 Google Scholar Authors : IK Budaraga, A Arnim, Y Marlinda, U Bulain Characteristics of cinnamon liquid smoke produced using several purification techniques American Journal of Food Science and Nutrition Research 3 (2), 16-21, 2016 13 2016
321 Google Scholar Authors : IK Budaraga, Y Marlinda, A Arnim, U Bulain Cattle cow dung use as an alternative energy source and organic fertilizer friendly enviroment village Kasang districts Batang Anai Padang Pariaman Journal of Scientific and Technology Research 5 (9), 159-173, 2016 4 2016
322 Google Scholar Authors : IK Budaraga, A Arnim, Y Marlinda, U Bulain Antibacterial Properties of Liquid Smoke from the Production of Cinnamon How Purification and Concentration of Different International Journal of Thesis Projects and Dissertations (IJTPD) 4 (2 …, 2016 10 2016
323 Google Scholar Authors : IK Budaraga, A Arnim, Y Marlinda, U Bulain Antioxidant properties of liquid smoke production variation of pyrolysis temperature raw and different concentration Journal of PharmTech Research 9 (6), 366-379, 2016 16 2016
324 Google Scholar Authors : IK Budaraga Arnim; Marlida, Y.; Bulanin, U., Analysis of liquid smoke chemical components with GC MS from different raw materials variation production and pyrolysis temperature level Int. J. ChemTech Res 9, 694-708, 2016 3 2016
325 Google Scholar Authors : A Aisyah, G Gusriati, IK Budaraga FACTORS WHICH WILL AFFECT THE GROWTH OF THE RUBBER ((Havea brasiliensis) IN THE PROVINCE OF WEST SUMATRA PASAMAN UNES Journal Of Scientech research 1 (1), 65-74, 2016 0 2016
326 Google Scholar Authors : IK Budaraga Effect Combination Treatment Different Concentration of Liquid Smoke, Immersion Duration, Packaging and Storage Duration to Organoleptic quality Fillet Tilapia Fish … International Journal of Advanced Scientific and Technical Research 2 (6 …, 2016 2 2016
327 Google Scholar Authors : IK Budaraga, Y Marlinda, A Arnim, U Bulain Cattle cow dung use as an alternative energy source and organic fertilizer friendly enviroment village Kasang districts Batang Anai Padang Pariaman Journal of Scientific and Technology Research 5 (9), 159-173, 2016 4 2016
328 Google Scholar Authors : IK Budaraga, YM Arnim Usman Bulanin. 2016. Liquid Smoke Production Quality from Raw Materials Variation and Different Pyrolysis Temperature Internastional Journal on Advance Science Engineering Information Technology …, 2016 3 2016
329 Google Scholar Authors : IK Budaraga, G Gusriati, H Gusvita, Z Zulfitriyana Analysis Of Factors Affecting Demand Red Chili Pepper (Capsicum Annum L) In Solok And Effort Fulfillment International Journal of Scientific & Technology Research 8 (3), 159-173, 2016 13 2016
330 Google Scholar Authors : IK Budaraga, A Arnim, Y Marlinda, U Bulain Characteristics of cinnamon liquid smoke produced using several purification techniques American Journal of Food Science and Nutrition Research 3 (2), 16-21, 2016 13 2016
331 Google Scholar Authors : IK Budaraga, A Arnim, Y Marlinda, U Bulain Toxicity of liquid smoke cinnamon (Cinnamomum Burmannii) production of ways for purification and different concentration Journal of Scientific and Research Publication 6 (7), 13-21, 2016 18 2016
332 Google Scholar Authors : IK Budaraga, F Fridarti Biogas Technology Application As One Of The Realization Of Kkn Ppm Integrated In Agricultural District Kanagarian kasang Batang Anai Padang Pariaman 0 2016
333 Google Scholar Authors : IK Budaraga, Y Marlinda, A Arnim, U Bulain Cattle cow dung use as an alternative energy source and organic fertilizer friendly enviroment village Kasang districts Batang Anai Padang Pariaman Journal of Scientific and Technology Research 5 (9), 159-173, 2016 4 2016
334 Google Scholar Authors : B I Ketut, F Fridarti Pembuatan Pakan Ternak Sapi dari Jerami menggunakan Ramuan Organik Ternak (ROTER) sebagai salah satu perwujudan Kegiatan KKN-PPM Terintegrasi di kanagarian Kasang kecamatan … Seminar Nasional Politekni Pertanian Negeri Payakumbuh 1 (1), 177-isi, 2016 0 2016
335 Google Scholar Authors : Z I Ketut Budaraga,Fridarti, Salamanang Pembuatan Pakan Ternak Sapi dari Jerami menggunakan Ramuan Organik Ternak (ROTER) sebagai salah satu perwujudan kegiatan KKN-PPM Pertanian Terintegrasi di Kanagarian Kasang Kecamatan Batang Anai Kabupaten Padang Pariaman Politeknik Pertanian Negeri Pertanian Payakumbuh 1, 177-198 0 2016
336 Google Scholar Authors : A Aisyah, G Gusriati, IK Budaraga FACTORS WHICH WILL AFFECT THE GROWTH OF THE RUBBER ((Havea brasiliensis) IN THE PROVINCE OF WEST SUMATRA PASAMAN UNES Journal Of Scientech research 1 (1), 65-74, 2016 0 2016
337 Google Scholar Authors : IK Budaraga Effect Combination Treatment Different Concentration of Liquid Smoke, Immersion Duration, Packaging and Storage Duration to Organoleptic quality Fillet Tilapia Fish … International Journal of Advanced Scientific and Technical Research 2 (6 …, 2016 2 2016
338 Google Scholar Authors : IK Budaraga Effect Combination Treatment Different Concentration of Liquid Smoke, Immersion Duration, Packaging and Storage Duration to Organoleptic quality Fillet Tilapia Fi... 0 2016
339 Google Scholar Authors : IK Budaraga, A Arnim, Y Marlinda, U Bulain Toxicity of liquid smoke cinnamon (Cinnamomum Burmannii) production of ways for purification and different concentration Journal of Scientific and Research Publication 6 (7), 13-21, 2016 18 2016
340 Google Scholar Authors : IK Budaraga Disertasi POTENSI ASAP CAIR DARI BERBAGAI SUMBER DAN APLIKASINYA SEBAGAI PENGAWET FILLET IKAN NILA (Oreochromis nilotica) Ilmu Pertanian program pasca sarjana Universitas Andalas, 2016 0 2016
341 Google Scholar Authors : W Budaraga IK, Rahmita, Gusriati, Leffy Hermalena Study on the Use of Green Bean as Skim Milk Substitution in Yellow Pumpkin (Cucurbita maxima) Ice Cream Proceedings of AESAP 2016 1 (-), 15-27, 2016 0 2016
342 Google Scholar Authors : B I Ketut, Arnim, M Yetti, B Usman Effect Combination Treatment Different Concentration of Liquid Smoke, Immersion Duration, Packaging and Storage Duration to Organoleptic quality Fillet Tilapia Fish … International Journal of Advanced Scientific and Technical Research 6 (2 … 1 2016
343 Google Scholar Authors : IK Budaraga Effect Combination Treatment Different Concentration of Liquid Smoke, Immersion Duration, Packaging and Storage Duration to Organoleptic quality Fillet Tilapia Fish … International Journal of Advanced Scientific and Technical Research 2 (6 …, 2016 3 2016
344 Google Scholar Authors : IK Budaraga, Arnim, Y Marlida, U Bulanin Antioxidant Properties Of Liquid Smoke Cinnamon Production Of Variation Of Purification And Different Concentration International Journal of Scientific & Technology Research 4 (8), 266-273, 2015 12 2015
345 Google Scholar Authors : IK Budaraga, Y Yurnalis Penerapan Iptek Bagi Masyarakat Kepada Petani Tebu Sirangkak Gadang dan Sarunai Maimbau di Korong Batang Selasih Kanagarian Bukit Batabuah Kecamatan Canduang Kabupaten Agam Jurnal Penelitian dan Kajian Ilmiah Menara Ilmu 9 (1), 180-190, 2015 0 2015
346 Google Scholar Authors : H Gusvita, IK Budaraga Analysis Of Factors Affecting Demand Red Chili Pepper Capsicum Annum L In Solok And Effort Fulfillment International Journal of Scientific & Technology Research 4 (8), 159-173, 2015 0 2015
347 Google Scholar Authors : L Permana, L Suhendra Optimasi konsentrasi VCO dalam mikroemulsi O/W dengan tiga surfaktan sebagai pembawa senyawa bioaktif Media Ilm. Teknol. Pangan 2, 106-114, 2015 8 2015
348 Google Scholar Authors : I Permana, L Suhendra, KB Jimbaran OPTIMASI KONSENTRASI VCO DALAM MIKROEMULSI O/W DENGAN TIGA SURFACTANT SEBAGAI PEMBAWA SENYAWA BIOAKTIF Media Ilmiah Teknologi Pangan (Scientific Journal of Food Technology) 2 (2 … 2 2015
349 Google Scholar Authors : I Permana, L Suhendra Optimasi konsentrasi VCO dalam mikroemulsi m/a dengan tiga surfaktan sebagai pembawa senyawa bioaktif Media Ilmiah Teknologi Pangan (Scientific Journal of Food Technology) 2 (2 … 2 2015
350 Google Scholar Authors : Y I Ketut Budaraga Penerapan Iptek Bagi Masyarakat bagi Petani Tebu dan Sarunai Maimbau Di Korong Batang Selasih Kanagarian Bukit Batabuah Kecamatan Canduang Kabupaten Agam Menara ilmu 220 (Vol 9 j. 1 No.62 Okt 2015 ISSN 1693-2617), 190-205, 2015 0 2015
351 Google Scholar Authors : I Permana, L Suhendra, KB Jimbaran OPTIMASI KONSENTRASI VCO DALAM MIKROEMULSI O/W DENGAN TIGA SURFACTANT SEBAGAI PEMBAWA SENYAWA BIOAKTIF Media Ilmiah Teknologi Pangan (Scientific Journal of Food Technology) 2 (2 … 2 2015
352 Google Scholar Authors : I Permana, L Suhendra Optimasi konsentrasi VCO dalam mikroemulsi m/a dengan tiga surfaktan sebagai pembawa senyawa bioaktif Media Ilmiah Teknologi Pangan (Scientific Journal of Food Technology) 2 (2 … 2 2015
353 Google Scholar Authors : Y I Ketut Budaraga Penerapan Iptek Bagi Masyarakat bagi Petani Tebu dan Sarunai Maimbau Di Korong Batang Selasih Kanagarian Bukit Batabuah Kecamatan Canduang Kabupaten Agam Menara ilmu 220 (Vol 9 j. 1 No.62 Okt 2015 ISSN 1693-2617), 190-205, 2015 0 2015
354 Google Scholar Authors : IK Budaraga, Y Yurnalis Penerapan Iptek Bagi Masyarakat Kepada Petani Tebu Sirangkak Gadang dan Sarunai Maimbau di Korong Batang Selasih Kanagarian Bukit Batabuah Kecamatan Canduang Kabupaten Agam Jurnal Penelitian dan Kajian Ilmiah Menara Ilmu 9 (1), 180-190, 2015 0 2015
355 Google Scholar Authors : IK Budaraga, S Syafruddin, G Gusriati, W Sumarno PELATIHAN PEMANFAATAN Limbah Kelapa (Lidi) Menjadi Kerajinan Tangan Di Nagari Iv Koto Mudik Kecamatan Batang Kapas Kabupaten Pesisir Selatan Buletin Udayana Mengabdi 8 (51), 100-105, 2014 3 2014
356 Google Scholar Authors : G I Ketut Budaraga Ibm Kelompok Tani Tagamang Bajawek di Kabupaten Padang Pariaman Sumbar Menara Ilmu 140 (Vol.VIII No. 44 Jan.2014 ISSN 1693-2617), 57-66, 2014 0 2014
357 Google Scholar Authors : IK Budaraga, R Abu Rancang bangun alat pengering hasil perikanan menggunakan kompor briket tempurung kelapa Laporan Penelitian Lembaga Penelitian dan Pengabdian Kepada Masyarakat …, 2014 5 2014
358 Google Scholar Authors : IK Budaraga Peningkatan Pendapatan Masyarakat Melalui Pemanfaatan Briket Tempurung Kelapa, Kompor Briket Dan Asap Cair Di Desa Sungai Rambai Kecamatan Pariaman Utara Kota Pariaman Provinsi … Jurnal Penelitian dan Kajian Ilmiah Menara Ilmu 8 (52), 30-35, 2014 0 2014
359 Google Scholar Authors : RA I Ketut Budaraga Peningkatan Pendapatan Masyarakat Melalui Pemanfaatan Briket Tempurung Kelapa,Kompor Briket dan Asap Cair Di Desa Sungai Rambai Kecamatan Pariaman Utara Kota PAriaman Menara ilmu 121 (Vol VIII No.52 Sept 2014 ISSN 1693-2617), 35-49, 2014 0 2014
360 Google Scholar Authors : IK Budaraga Utilization Using Liquid Smoke Fish Fillet As Preservatives 1 2014
361 Google Scholar Authors : IK Budaraga, P Novia Ibm Kelompok Organisasi Padat Karya 4 Sajarek Jurnal Penelitian dan Kajian Ilmiah Menara Ilmu 8 (51), 34-38, 2014 0 2014
362 Google Scholar Authors : IK Budaraga Utilization Using Liquid Smoke Fish Fillet As Preservatives 1 2014
363 Google Scholar Authors : IK Budaraga, A Asnurita IBM Kelompok Budidaya Ikan Maju Bersama Jurnal Penelitian dan Kajian Ilmiah Menara Ilmu 8 (53), 37-43, 2014 0 2014
364 Google Scholar Authors : IK Budaraga, G Gusriati Kajian Mutu Mikrobiologi Fillet Lele Asap yang diberi asap cair kayu manis Buletin Ilmiah Ekasakti 26 (1), 92-108, 2014 0 2014
365 Google Scholar Authors : IK Budaraga, R Abu Rancang bangun alat pengering hasil perikanan menggunakan kompor briket tempurung kelapa Laporan Penelitian Lembaga Penelitian dan Pengabdian Kepada Masyarakat …, 2014 5 2014
366 Google Scholar Authors : G I Ketut Budaraga Ibm Kelompok Tani Tagamang Bajawek di Kabupaten Padang Pariaman Sumbar Menara Ilmu 140 (Vol.VIII No. 44 Jan.2014 ISSN 1693-2617), 57-66, 2014 0 2014
367 Google Scholar Authors : IK Budaraga Peningkatan Pendapatan Masyarakat Melalui Pemanfaatan Briket Tempurung Kelapa, Kompor Briket Dan Asap Cair Di Desa Sungai Rambai Kecamatan Pariaman Utara Kota Pariaman Provinsi … Jurnal Penelitian dan Kajian Ilmiah Menara Ilmu 8 (52), 30-35, 2014 0 2014
368 Google Scholar Authors : RA I Ketut Budaraga Peningkatan Pendapatan Masyarakat Melalui Pemanfaatan Briket Tempurung Kelapa,Kompor Briket dan Asap Cair Di Desa Sungai Rambai Kecamatan Pariaman Utara Kota PAriaman Menara ilmu 121 (Vol VIII No.52 Sept 2014 ISSN 1693-2617), 35-49, 2014 0 2014
369 Google Scholar Authors : IK Budaraga, G Gusriati Kajian Mutu Mikrobiologi Fillet Lele Asap yang diberi asap cair kayu manis Buletin Ilmiah Ekasakti 26 (1), 92-108, 2014 0 2014
370 Google Scholar Authors : G Budaraga I Ketut Kajian Mutu Pillet Lele Asap yang Diberikan Asap Cair Kayu Manis Buletin Ilmiah Ekasakti 26 (1), 0854-8099, 2014 0 2014
371 Google Scholar Authors : IK Budaraga, G Gusriati Kajian Mutu Mikrobiologi Fillet Lele Asap yang diberi asap cair kayu manis Buletin Ilmiah Ekasakti 26 (1), 92-108, 2014 0 2014
372 Google Scholar Authors : IK Budaraga Peningkatan Pendapatan Masyarakat Melalui Pemanfaatan Briket Tempurung Kelapa, Kompor Briket Dan Asap Cair Di Desa Sungai Rambai Kecamatan Pariaman Utara Kota Pariaman Provinsi … Jurnal Penelitian dan Kajian Ilmiah Menara Ilmu 8 (52), 30-35, 2014 0 2014
373 Google Scholar Authors : G I Ketut Budaraga Ibm Kelompok Tani Tagamang Bajawek di Kabupaten Padang Pariaman Sumbar Menara Ilmu 140 (Vol.VIII No. 44 Jan.2014 ISSN 1693-2617), 57-66, 2014 0 2014
374 Google Scholar Authors : IK Budaraga, P Novia Ibm Kelompok Organisasi Padat Karya 4 Sajarek Jurnal Penelitian dan Kajian Ilmiah Menara Ilmu 8 (51), 34-38, 2014 0 2014
375 Google Scholar Authors : IK Budaraga Peningkatan Pendapatan Masyarakat Melalui Pemanfaatan Briket Tempurung Kelapa, Kompor Briket Dan Asap Cair Di Desa Sungai Rambai Kecamatan Pariaman Utara Kota Pariaman Provinsi … Jurnal Penelitian dan Kajian Ilmiah Menara Ilmu 8 (52), 30-35, 2014 0 2014
376 Google Scholar Authors : RA I Ketut Budaraga Peningkatan Pendapatan Masyarakat Melalui Pemanfaatan Briket Tempurung Kelapa,Kompor Briket dan Asap Cair Di Desa Sungai Rambai Kecamatan Pariaman Utara Kota PAriaman Menara ilmu 121 (Vol VIII No.52 Sept 2014 ISSN 1693-2617), 35-49, 2014 0 2014
377 Google Scholar Authors : IK Budaraga, A Asnurita IBM Kelompok Budidaya Ikan Maju Bersama Jurnal Penelitian dan Kajian Ilmiah Menara Ilmu 8 (53), 37-43, 2014 0 2014
378 Google Scholar Authors : gusriati I Ketut Budaraga Kajian Mutu Filet Lele Asap yang diberikan Asap Cair Kayu Manis Seminar Nasional Peranan Teknologi Pangan dan Gizi Dalam Meningkatkan Mutu …, 2013 0 2013
379 Google Scholar Authors : J I Ketut Budaraga, Rizal Abu Kompor Briket Tahan Panas 0 2013
380 Google Scholar Authors : IK Budaraga, A Arnim, Y Marlinda, U Bulain Antioxidant properties of liquid smoke cinnamon production of variation of purification and different concentration International Journal of Scientific & Technology Research 5 (6), 266-273, 2013 16 2013
381 Google Scholar Authors : IK Budaraga, A Arnim, Y Marlinda, U Bulain Antioxidant properties of liquid smoke cinnamon production of variation of purification and different concentration International Journal of Scientific & Technology Research 5 (6), 266-273, 2013 16 2013
382 Google Scholar Authors : J I Ketut Budaraga, Rizal Abu Kompor Briket Tahan Panas 0 2013
383 Google Scholar Authors : IK Budaraga Pendidikan Pemanfaatan Asap Cair Sebagai Pengawet Bahan Pangan yang Ramah Lingkungan International Conference on Global Education 1, 24-36, 2013 2 2013
384 Google Scholar Authors : G I Ketut Budaraga Ibm Kelompok Usaha Roda Banting dan Kelompok Tani Rambai Sakato di Kota Pariaman Menara Ilmu 190 (Vol VIII no. 41 Okt 2013 ISSN 1693-2617), 38-43, 2013 0 2013
385 Google Scholar Authors : IKB dan gusriati Kajian efek antioksidan asap cair kayu manis untuk menghambat oksidasi lemak pada filet ikan nila (oriochromis nilotica) asap selama penyimpanan pada suhu kamar Ekotrans 214 (Volume.12 No. 1 Januari 2012), 191-214, 2012 0 2012
386 Google Scholar Authors : IK Budaraga Potensi, Permasalahan, Tantangan Dan Strategi Pembangunan Pertanian Ke Depan Jurnal Ekotrans 12 (2), 1-17, 2012 0 2012
387 Google Scholar Authors : G I Ketut Budaraga Kajian Mutu Kimia Filet Lele Asap yang diberikan asap cair kayu manis Ekasakti 126 (Volume XXIV No. 1 Januari 2013), 102-120, 2012 0 2012
388 Google Scholar Authors : IK Budaraga Dampak Bahaya Senyawa Benzoepiren yang terdapat dalam asap cair Buletin Ilmiah Ekasakti 22 (1), 8-27, 2012 0 2012
389 Google Scholar Authors : IK Budaraga Dampak Bahaya Senyawa Benzoepiren yang terdapat dalam asap cair Buletin Ilmiah Ekasakti 22 (1), 8-27, 2012 0 2012
390 Google Scholar Authors : IK Budaraga Potensi, Permasalahan, Tantangan Dan Strategi Pembangunan Pertanian Ke Depan Jurnal Ekotrans 12 (2), 1-17, 2012 0 2012
391 Google Scholar Authors : IK Budaraga Dampak Bahaya Senyawa Benzoepiren yang terdapat dalam asap cair Buletin Ilmiah Ekasakti 22 (1), 8-27, 2012 0 2012
392 Google Scholar Authors : IK Budaraga Pemanfaatan Air Kelapa Menjadi Produk Olahan Kecap dan Kesehatan Buletin Ilmiah Ekasakti 20 (1), 66-70, 2011 0 2011
393 Google Scholar Authors : IK Budaraga Innovation Coconut Shell Briquette Stove as Alternative Substitution of Fuel Oil in Pariaman Jurnal Ekotrans Jurnal Pemikiran dan Analisis masalah Ekologi dan …, 2011 0 2011
394 Google Scholar Authors : IK Budaraga Potensi Pemanfaatan Asap Cair Sebagai Pengawet Bahan Pangan Jurnal Ekotrans: Jurnal Pemikiran Dan Analisis Masalah Ekologi Dan …, 2011 1 2011
395 Google Scholar Authors : IK Budaraga Pemanfaatan Air Kelapa menjadi produk kecap dan kesehatan Buletin Ilmiah EKASAKTI 20 (1), 66-70, 2011 0 2011
396 Google Scholar Authors : IK Budaraga Pemanfaatan Air Kelapa Menjadi Produk Olahan Kecap dan Kesehatan Buletin Ilmiah Ekasakti 20 (1), 66-70, 2011 0 2011
397 Google Scholar Authors : IK Budaraga Pengenalan Sistem Penerapan Pertanian Organik Pada Masyarakat Buletin Ilmiah Ekasakti 21 (2), 1-14, 2011 0 2011
398 Google Scholar Authors : IK Budaraga Pengenalan Sistem Penerapan Pertanian Organik Pada Masyarakat Buletin Ilmiah Ekasakti 21 (2), 1-14, 2011 0 2011
399 Google Scholar Authors : IK Budaraga Pengenalan Sistem Pertanian Organik kepada Masyarakat Ekasakti 125 (Vol 21.N0.2 Agustus 2011 ISSN 0854-8099), 1-14, 2011 0 2011
400 Google Scholar Authors : IK Budaraga Potensi Pemanfaatan Asap Cair Sebagai Pengawet Bahan Pangan Jurnal Ekotrans: Jurnal Pemikiran Dan Analisis Masalah Ekologi Dan …, 2011 1 2011
401 Google Scholar Authors : IK Budaraga Pemanfaatan Air Kelapa Menjadi Produk Olahan Kecap dan Kesehatan Buletin Ilmiah Ekasakti 20 (1), 66-70, 2011 0 2011
402 Google Scholar Authors : IK Budaraga Uji Kinerja Alat dan Identifikasi Produk Asap Cair Kayu Manis Pada Berbagai Waktu Pirolisis dan Cara Pemurnian Untuk Pengawet Filet Ikan Nila (Oreochromis nilotica) Buletin Ilmiah Ekasakti 20 (1), 137-165, 2011 0 2011
403 Google Scholar Authors : IK Budaraga Potensi Pemanfaatan Asap Cair Sebagai Pengawet Bahan Pangan Jurnal Ekotrans: Jurnal Pemikiran Dan Analisis Masalah Ekologi Dan …, 2011 1 2011
404 Google Scholar Authors : IK Budaraga Pengenalan Sistem Penerapan Pertanian Organik Pada Masyarakat Buletin Ilmiah Ekasakti 21 (2), 1-14, 2011 0 2011
405 Google Scholar Authors : IK Budaraga Pemanfaatan Air Kelapa menjadi produk kecap dan kesehatan Buletin Ilmiah EKASAKTI 20 (1), 66-70, 2011 0 2011
406 Google Scholar Authors : IK Budaraga Strategi dan Peluang Pemanfaatan Teknologi Tepat Guna (TTG) dalam Meningkatkan Usaha Masyarakat Ekasakti 131 (Vol.19 No.2 Juli 2010 ISSN 0854-8099), 13-38, 2010 0 2010
407 Google Scholar Authors : IK Budaraga Percepatan Difusi dan Pemanfaatan Iptek Penerapan Inovasi Bioteknologi NT 45 dalam Penglolaan Tambak Air Payau Untuk peningkatan Pendapatan Masyarakat... Ekontrans 186 (Vol.10 No.2 Juli 2010 ISSN 1411-4615), 164-176 0 2010
408 Google Scholar Authors : IK Budaraga Pemanfaatan Asap Cair Tempurung Kelapa sebagai Pengawet Ikan Teri di Kelurahan Pasie Nan Tigo Kecamatan Koto Tangah Kota Padang Jurnal Ekotrans Jurnal Pemikiran dan Analisis masalah Ekologi dan …, 2010 0 2010
409 Google Scholar Authors : IK Budaraga Percepatan Difusi dan Pemanfaatan Iptek Pengolahan Tempurung Kelapa Menjadi Briket sebagai Alternatif Pengganti BBM di Kota Pariaman Provinsi Sumatera Barat Jurnal Ekotrans Jurnal Pemikiran dan Analisis masalah Ekologi dan …, 2010 0 2010
410 Google Scholar Authors : IK Budaraga Pemanfaatan Asap Cair Tempurung Kelapa sebagai Pengawet Ikan Teri di Kelurahan Pasie Nan Tigo Kecamatan Koto Tangah Kota Padang Jurnal Ekotrans Jurnal Pemikiran dan Analisis masalah Ekologi dan …, 2010 0 2010
411 Google Scholar Authors : IK Budaraga Pemanfaatan Asap Cair Tempurung Kelapa sebagai Pengawet Ikan Teri di Kelurahan Pasie Nan Tigo Kecamatan Koto Tangah Kota Padang Jurnal Ekotrans Jurnal Pemikiran dan Analisis masalah Ekologi dan …, 2010 0 2010
412 Google Scholar Authors : IK Budaraga Percepatan Difusi dan Pemanfaatan Iptek Penerapan Inovasi Bioteknologi NT 45 dalam Penglolaan Tambak Air Payau Untuk peningkatan Pendapatan Masyarakat di Daerah Pesisir Ekontrans 186 (Vol.10 No.2 Juli 2010 ISSN 1411-4615), 164-176, 2010 0 2010
413 Google Scholar Authors : IK Budaraga Percepatan Difusi dan Pemanfaatan iptek Pengolahan Tempurung kelapa Menjadi Briket Sebagai Alternatif Pengganti BBM di Kota Pariaman Provinsi Sumatera Ba... Ekotrans 186 (Vol.10 No.2 Juli 2010 ISSN 1411-4615), 71-87 0 2010
414 Google Scholar Authors : D I Ketut Budaraga Teknologi Pembuatan Pupuk Organik Majemuk Lengkap dengan Memanfaatkan Bioteknologi NT 45 Ekotrans 183 (Vol 9 No. 2 Juli 2009 ISSN 1411-4615), 21-27, 2009 0 2009
415 Google Scholar Authors : IK Budaraga Pengolahan Limbah Tapioka Menjadi Biogas (Energi Alternatif) Jurnal Ekotrans Jurnal Pemikiran dan Analisis masalah Ekologi dan …, 2009 0 2009
416 Google Scholar Authors : IK Budaraga Kombinasi penambahan tepung karagenan dengan alkali terhadap terhadap beberapa kualitas bakso ikan tenggiri Ekasakti 134 (Vol.16 No.1 Jan.2009 ISSN 0854-8099), 78-93, 2009 0 2009
417 Google Scholar Authors : IK Budaraga Potensi pemanfaatan Tempurung Sawit sebagai Bahan Baku Pembuatan Briket,Arang Aktif,Fenol dan Asap Cair Ekotrans 183 (Vol 9 No.2 Juli 2009), 56-65, 2009 0 2009
418 Google Scholar Authors : IK Budaraga Potensi Tempurung Sawit Sebagai Bahan Baku Pembuatan Briket, Arang Aktif, Fenol Dan Asap Cair Buletin Ilmiah Ekasakti 16 (1), 78-93, 2009 0 2009
419 Google Scholar Authors : IK Budaraga Pengolahan Limbah Tapioka Menjadi Biogas (Energi Alternatif) Jurnal Ekotrans Jurnal Pemikiran dan Analisis masalah Ekologi dan …, 2009 0 2009
420 Google Scholar Authors : IK Budaraga Potensi Tempurung Sawit Sebagai Bahan Baku Pembuatan Briket, Arang Aktif, Fenol Dan Asap Cair Buletin Ilmiah Ekasakti 16 (1), 78-93, 2009 0 2009
421 Google Scholar Authors : MS Ir. I Ketut Budaraga Inovasi Teknologi Pembuatan briket dari Tempurung Kelapa Sebagai Alternatif Pengganti BBM di Kota Pariaman Buletin Iptekda LIPI 33 (Edisi Khusus Nov.2009 ISSN 1411-6707), 16-18, 2009 0 2009
422 Google Scholar Authors : gusriati I Ketut Budaraga Pengaruh Pemberian Berbagai Konsentrasi Asap Cair Tempurung Kelapa Terhadap Mutu Pengolahan Ikan Teri dalam Rangka Peningkatan Kualitas Hasil Perikanan di Kabupaten Pesisir Selatan SIGMATEK (Jurnal Sains dan Teknologi) 256 (Vol.2 N.2 Sept.2008 ISSN 1978 …, 2008 0 2008
423 Google Scholar Authors : IK Budaraga Tempurung Kelapa Untuk Mengawetkan Ikan Jurnal: Samudra 6 (64), 26-27, 2008 0 2008
424 Google Scholar Authors : gusriati I Ketut Budaraga Pengaruh Pemberian Berbagai Konsentrasi Asap Cair Tempurung Kelapa Terhadap Mutu Pengolahan Ikan Teri dalam Rangka Peningkatan Kualitas Hasil Perikan... SIGMATEK (Jurnal Sains dan Teknologi) 256 (Vol.2 N.2 Sept.2008 ISSN 1978 … 0 2008
425 Google Scholar Authors : IK Budaraga Prospek Tepung Sukun Untuk Berbagai Produk Makanan Olahan Dalam Upaya Menunjang Diversifikasi Pangan Jurnal Ekotrans: Jurnal Pemikiran Dan Analisis Masalah Ekologi Dan …, 2008 0 2008
426 Google Scholar Authors : IK Budaraga Tempurung Kelapa Untuk Mengawetkan Ikan Jurnal: Samudra 6 (64), 26-27, 2008 0 2008
427 Google Scholar Authors : nursal idris I Ketut Budaraga,Darmansyah, abdul razal Percepatan difusi dan pemanfaatan iptek penerapan bioteknologi NT 45 di Bidang Budidaya Perikanan pada Kolam Pendederan Terhadap Pertumbuhan Bibit Ikan Nila aquaculture 2008 Indonesia Partnership and Inovation for Sustanainable …, 2008 0 2008
428 Google Scholar Authors : IK Budaraga Prospek Tepung Sukun Untuk Berbagai Produk Makanan Olahan Dalam Upaya Menunjang Diversifikasi Pangan Jurnal Ekotrans: Jurnal Pemikiran Dan Analisis Masalah Ekologi Dan …, 2008 0 2008
429 Google Scholar Authors : nursal idris I Ketut Budaraga,Darmansyah, abdul razal Percepatan difusi dan pemanfaatan iptek penerapan bioteknologi NT 45 di Bidang Budidaya Perikanan pada Kolam Pendederan Terhadap Pertumbuhan Bibit Ikan... aquaculture 2008 Indonesia Partnership and Inovation for Sustanainable … 0 2008
430 Google Scholar Authors : IK Budaraga Performance Characteristics Of Cocoa Skin Liquid Smokersin Different Water Content Conditions inter 10 (15), 2001 0 2001
431 Google Scholar Authors : IK Budaraga Strategi Dan Peluang Pemanfaatan Teknologi Tepat Guna (TTG) Dalam Meningkatkan Usaha Masyarakat Buletin Ilmiah Ekasakti 19 (2), 13-38, 2001 0 2001
432 Google Scholar Authors : IK Budaraga Performance Characteristics Of Cocoa Skin Liquid Smokersin Different Water Content Conditions inter 10 (15), 2001 0 2001
433 Google Scholar Authors : IK Budaraga Strategi Dan Peluang Pemanfaatan Teknologi Tepat Guna (TTG) Dalam Meningkatkan Usaha Masyarakat Buletin Ilmiah Ekasakti 19 (2), 13-38, 2001 0 2001
434 Google Scholar Authors : 0 2000
435 Google Scholar Authors : IK Budaraga Tesis Pengkajian Respirasi Buah Mangga dan Salak Terolah Minimal Selama Penyimpanan Program Studi Teknik Pasca Panen Institut Pertanian Bogor, 1998 0 1998
436 Google Scholar Authors : IK Budaraga Pengkajian respirasi buah mangga dan salak terolah minimal selama penyimpanan IPB (Bogor Agricultural University), 1998 3 1998
437 Google Scholar Authors : IK Budaraga Pengkajian respirasi buah mangga dan salak terolah minimal selama penyimpanan IPB (Bogor Agricultural University), 1998 3 1998
438 Google Scholar Authors : IK Budaraga Skripsi Pengaruh Blanching dan Pemberian Natrium Metabisulfit Terhadap Beberapa komponen Mutu Tepung Pisang Kepok (musa parasidiaca) Universitas Mataram, 1992 0 1992
439 Google Scholar Authors : IK Budaraga BAB 2 ILMU SUSU ILMU PANGAN JILID 2, 15, 0 0 0000
440 Google Scholar Authors : IK Budaraga, YM Arnim Usman Bulanin,. 2016. Antioxidant Properties of Liquid Smoke Cinnamon Production of Variation Purification and Different Concentration International Journal of Scientific & Technology Research (IJSTR). ISSN ISSN …, 0 5 0000
441 Google Scholar Authors : YM Sari Asnurita dan I Ketut Budaraga 2017 Pengaruh Konsentrasi Starter Acetobacter Xylinum Terhadap Mutu Nata De …, 0 0 0000
442 Google Scholar Authors : IK Budaraga, YM Arnim Usman Bulanin,. 2016. Antioxidant Properties of Liquid Smoke Cinnamon Production of Variation Purification and Different Concentration International Journal of Scientific & Technology Research (IJSTR). ISSN ISSN …, 0 5 0000
443 Google Scholar Authors : IMP Bungsu, IK Budaraga, N Yessirita JURNAL RESEARCH ILMU PERTANIAN (JRIP) 0 0000
444 Google Scholar Authors : Y Mayang Sari Ketut Budaraga Universitas Ekasakti AI 2017 Pengaruh konsentrasi starter acetobacter xylinum terhadap mutu nata de cucumber J. Pertan. UMSB 1, 2527-3663, 0 3 0000
445 Google Scholar Authors : IK Budaraga Kajian Mutu Pillet Lele Asap yang Diberikan Asap Cair Kayu Manis 0 0000
446 Google Scholar Authors : CL Suryani, AP Kamarudin, IK Budaraga, N Suhartatik, E Julianti, U Pato, ... PENGEMBANGAN PANGAN FUNGSIONAL 0 0000
447 Google Scholar Authors : IK Budaraga, YM Arnim Usman Bulanin,. 2016. Antioxidant Properties of Liquid Smoke Cinnamon Production of Variation Purification and Different Concentration International Journal of Scientific & Technology Research (IJSTR). ISSN ISSN …, 0 5 0000
448 Google Scholar Authors : G Zulfitriyana, H Gusvita, IK Budaraga Analysis Of Factors Affecting Demand Red Chili Pepper (Capsicum Annum L) In Solok And Effort Fulfillment 0 0000
449 Google Scholar Authors : IK Budaraga BAB 4 ILMU SAGU ILMU PANGAN JILID, 53, 0 0 0000
450 Google Scholar Authors : I Ketut Budaraga, M Arnim Y., & Bulanin, U.(2016). Analysis of liquid smoke chemical components with GC MS from different raw materials variation production and pyrolysis temperaturelevel International Journal of ChemTech Research 9 (6), 694-708, 0 5 0000
451 Google Scholar Authors : IK Budaraga, YM Arnim Usman Bulanin,. 2016. Liquid Smoke Toxicity Properties of Production of Raw Materials With Variation of Temperature and Concentration of Different International Journal of PharmTech Research 9 (10), 0 9 0000
452 Google Scholar Authors : IK Budaraga, EA Murnita Penyuluhan Manfaat Penerapan Pertanian Organik Di Kelompok Tani Kampung Apar Nagari Se Buluh Kecamatan Batang Anai Kabupaten Padang Pariaman Seminar Nasional Sosial Ekonomi 2019, 93 1 0000
453 Google Scholar Authors : I Ketut Budaraga, M Arnim Y., & Bulanin, U.(2016). Analysis of liquid smoke chemical components with GC MS from different raw materials variation production and pyrolysis temperaturelevel International Journal of ChemTech Research 9 (6), 694-708, 0 5 0000
454 Google Scholar Authors : BK Lahati, Y Nurmayanti, U Pato, STC Murti, IK Budaraga, HJD Lalel, ... KEAMANAN PANGAN 0 0000
455 Google Scholar Authors : IK Budaraga Effect of Combination Treatment of Liquid Smoke Concentration, Soaking Time, Packaging and Different Storage Time To Yield And Moisture Contentnila Fish Fillet 0 0000
456 Google Scholar Authors : IK Budaraga, YM Arnim Usman Bulanin,. 2016. Antioxidant Properties of Liquid Smoke Production Variation of Pyrolysis Temperature Raw and Different Concentration International Journal of PharmTech Research 9 (6), 366-379, 0 8 0000
457 Google Scholar Authors : YM Sari Asnurita dan I Ketut Budaraga 2017 Pengaruh Konsentrasi Starter Acetobacter Xylinum Terhadap Mutu Nata De …, 0 0 0000
458 Google Scholar Authors : IK Budaraga, S Syafrudin, G Gusriati, W Sumarno Pelatihan Pemanfaatan Limbah Kelapa (Lidi) Menjadi Kerajinan Tangan di Nagari IV Koto Mudik Kecamatan Batang Kapas Kabupaten Pesisir Selatan Buletin Udayana Mengabdi 18 (3) 0 0000
459 Google Scholar Authors : N Nordin, M Tan, AN Latfa, P Tambahan, K Disini, SPM KeDiPay, ... Sub Tema 0 0000
460 Google Scholar Authors : BK Lahati, Y Nurmayanti, U Pato, STC Murti, IK Budaraga, HJD Lalel, ... KEAMANAN PANGAN 0 0000
461 Google Scholar Authors : IK Budaraga BAB 4 ILMU SAGU ILMU PANGAN JILID, 53, 0 0 0000
462 Google Scholar Authors : DK Sari, E Zelpina, N Fati, A Muchlis, IW Sulendre, IK Budaraga ILMU TEKNOLOGI HASIL TERNAK 0 0000
463 Google Scholar Authors : IK Budaraga, R Abu Jamaludin, 2013 Kompor Briket Tahan Panas (Paten no. ID S0001244 tanggal 19 Maret 2013 …, 0 5 0000
464 Google Scholar Authors : IK Budaraga, YM Arnim Usman Bulanin,. 2016. Analysis Of Liquid Smoke Chemical Components With GC MS From Differenft Raw Materials Variation Production And Pyrolysis Temperature Level International Journal of ChemTech Research 9 (6), 0 4 0000
465 Google Scholar Authors : YM Sari Asnurita dan I Ketut Budaraga 2017 Pengaruh Konsentrasi Starter Acetobacter Xylinum Terhadap Mutu Nata De …, 0 0 0000
466 Google Scholar Authors : IK Budaraga, Y Marlida, U Bulanin Arnim.(2017). Chemical components analysis of Cinnamon liquid smoke with GC MS from various production of different purification method International Journal of Chemical Technology Research 10 (1), 12-26 6 0000
467 Google Scholar Authors : MIF Gunawan, AP Riandani, ERM Saleh, I Rodianawati, IK Budaraga, ... TEKNIK EVALUASI SENSORI PRODUK 0 0000
468 Google Scholar Authors : IK Budaraga BAB 2 ILMU SUSU ILMU PANGAN JILID 2, 15, 0 0 0000
469 Google Scholar Authors : G Zulfitriyana, H Gusvita, IK Budaraga Analysis Of Factors Affecting Demand Red Chili Pepper (Capsicum Annum L) In Solok And Effort Fulfillment 0 0000
470 Google Scholar Authors : M Sari Yenti, and Asnurita I dan Ketut Budaraga Universitas Ekasakti. 2017 Pengaruh Konsentrasi Starter Acetobacter Xylinum Terhadap Mutu Nata De …, 0 0 0000
471 Google Scholar Authors : YM Sari Asnurita dan I Ketut Budaraga 2017 Pengaruh Konsentrasi Starter Acetobacter Xylinum Terhadap Mutu Nata De …, 0 0 0000
472 Google Scholar Authors : IK Budaraga, EA Murnita Penyuluhan Manfaat Penerapan Pertanian Organik Di Kelompok Tani Kampung Apar Nagari Se Buluh Kecamatan Batang Anai Kabupaten Padang Pariaman Seminar Nasional Sosial Ekonomi 2019, 93 1 0000
473 Google Scholar Authors : A Wijinindyah, E Julianti, IK Budaraga, S Priyadi, SD Astuti, N Albaar, ... EVALUASI GIZI HASIL PERTANIAN 0 0000
474 Google Scholar Authors : BK Lahati, Y Nurmayanti, U Pato, STC Murti, IK Budaraga, HJD Lalel, ... KEAMANAN PANGAN 0 0000
475 Google Scholar Authors : IK Budaraga, YM Arnim Usman Bulanin,. 2016. Analysis Of Liquid Smoke Chemical Components With GC MS From Differenft Raw Materials Variation Production And Pyrolysis Temperature Level International Journal of ChemTech Research 9 (6), 0 4 0000
476 Google Scholar Authors : IK Budaraga Effect of Combination Treatment of Liquid Smoke Concentration, Soaking Time, Packaging and Different Storage Time To Yield And Moisture Contentnila Fish Fillet 0 0000
477 Google Scholar Authors : I Ketut Budaraga, M Arnim Y., & Bulanin, U.(2016). Analysis of liquid smoke chemical components with GC MS from different raw materials variation production and pyrolysis temperaturelevel International Journal of ChemTech Research 9 (6), 694-708, 0 5 0000
478 Google Scholar Authors : IK Budaraga, YM Arnim Usman Bulanin,. 2016. Antioxidant Properties of Liquid Smoke Production Variation of Pyrolysis Temperature Raw and Different Concentration International Journal of PharmTech Research 9 (6), 366-379, 0 8 0000
479 Google Scholar Authors : BK Lahati, Y Nurmayanti, U Pato, STC Murti, IK Budaraga, HJD Lalel, ... KEAMANAN PANGAN 0 0000
480 Google Scholar Authors : A Wijinindyah, E Julianti, IK Budaraga, S Priyadi, SD Astuti, N Albaar, ... EVALUASI GIZI HASIL PERTANIAN 0 0000
481 Google Scholar Authors : LO Nelwan, U Ahmad, R Hasbullah, IW Astika Proceedings of AESAP 2016 The 1 st International Conference on the Role of Agricultural Engineering for Sustainable Agriculture Production 0 0000
482 Google Scholar Authors : MIF Gunawan, AP Riandani, ERM Saleh, I Rodianawati, IK Budaraga, ... TEKNIK EVALUASI SENSORI PRODUK 0 0000
483 Google Scholar Authors : CL Suryani, AP Kamarudin, IK Budaraga, N Suhartatik, E Julianti, U Pato, ... PENGEMBANGAN PANGAN FUNGSIONAL 0 0000
484 Google Scholar Authors : IK Budaraga, YM Arnim Usman Bulanin,. 2016. Antioxidant Properties of Liquid Smoke Cinnamon Production of Variation Purification and Different Concentration International Journal of Scientific & Technology Research (IJSTR). ISSN ISSN …, 0 5 0000
485 Google Scholar Authors : IK Budaraga BAB 2 ILMU SUSU ILMU PANGAN JILID 2, 15, 0 0 0000
486 Google Scholar Authors : IMP Bungsu, IK Budaraga, N Yessirita JURNAL RESEARCH ILMU PERTANIAN (JRIP) 0 0000
487 Google Scholar Authors : Y Mayang Sari Ketut Budaraga Universitas Ekasakti AI 2017 Pengaruh konsentrasi starter acetobacter xylinum terhadap mutu nata de cucumber J. Pertan. UMSB 1, 2527-3663, 0 3 0000
488 Google Scholar Authors : CFMSON BANDAR Study of Escherichia Coli and Salmonella Sp. Bacterial Contamination from Meatball Seller on Bandar Buat Market in Padang City 0 0000
489 Google Scholar Authors : IK Budaraga, Y Marlida, U Bulanin Arnim.(2017). Chemical components analysis of Cinnamon liquid smoke with GC MS from various production of different purification method International Journal of Chemical Technology Research 10 (1), 12-26, 0 7 0000
490 Google Scholar Authors : M Sari Yenti, and Asnurita I dan Ketut Budaraga Universitas Ekasakti. 2017 Pengaruh Konsentrasi Starter Acetobacter Xylinum Terhadap Mutu Nata De …, 0 0 0000
491 Google Scholar Authors : ENM Lubis, G Ali, R Wikansari, RPA Hasibuan, A Dilham, MUM Putra, ... No Title Page 0 0000
492 Google Scholar Authors : BK Lahati, Y Nurmayanti, U Pato, STC Murti, IK Budaraga, HJD Lalel, ... KEAMANAN PANGAN 0 0000
493 Google Scholar Authors : I Ketut Budaraga, M Arnim Y., & Bulanin, U.(2016). Analysis of liquid smoke chemical components with GC MS from different raw materials variation production and pyrolysis temperaturelevel International Journal of ChemTech Research 9 (6), 694-708, 0 5 0000
494 Google Scholar Authors : IK Budaraga, E Susanti Study of Toxicity of Cacao Skin Liquid (Theobroma cacao, L) Using BSLT Method (Brine Shrimp Lethality Test) 0 0000
495 Google Scholar Authors : IK Budaraga, YM Arnim Usman Bulanin,. 2016. Antioxidant Properties of Liquid Smoke Cinnamon Production of Variation Purification and Different Concentration International Journal of Scientific & Technology Research (IJSTR). ISSN ISSN …, 0 5 0000
496 Google Scholar Authors : YM Sari Asnurita dan I Ketut Budaraga 2017 Pengaruh Konsentrasi Starter Acetobacter Xylinum Terhadap Mutu Nata De …, 0 0 0000
497 Google Scholar Authors : BK Lahati, Y Nurmayanti, U Pato, STC Murti, IK Budaraga, HJD Lalel, ... KEAMANAN PANGAN 0 0000
498 Google Scholar Authors : IK Budaraga, RA Salihat Antioxidant Activity of ‘Broken Skin’Purple Rice,‘Skinned’Purple Rice, and Purple Rice Stem Organically Cultivated in Indonesia 1 0000
499 Google Scholar Authors : IS Utami, S Wulandari, I Yusti, MI Yahfizham, WA Purnomo, ... No Title Page 0 0000
500 Google Scholar Authors : IK Budaraga, YM Arnim Usman Bulanin,. 2016. Liquid Smoke Toxicity Properties of Production of Raw Materials With Variation of Temperature and Concentration of Different International Journal of PharmTech Research 9 (10), 0 9 0000
501 Google Scholar Authors : CL Suryani, AP Kamarudin, IK Budaraga, N Suhartatik, E Julianti, U Pato, ... PENGEMBANGAN PANGAN FUNGSIONAL 0 0000
502 Google Scholar Authors : IK Budaraga, RA Salihat Antioxidant Activity of ‘Broken Skin’Purple Rice,‘Skinned’Purple Rice, and Purple Rice Stem Organically Cultivated in Indonesia 1 0000
503 Google Scholar Authors : IK Budaraga, YM Arnim Usman Bulanin,. 2016. Liquid Smoke Toxicity Properties of Production of Raw Materials With Variation of Temperature and Concentration of Different International Journal of PharmTech Research 9 (10), 0 9 0000
504 Google Scholar Authors : IK Budaraga, Y Oktavia, L Hermalena Study of the Quality chemical of Fresh Drinks Corens with the Use of Different Types of Oranges 0 0000
505 Google Scholar Authors : RA Salihat Heavy metals analysis (Cd, Pb, Zn, Cu, Cr) and Calcium in Padang and Padang Panjang 0 0000
506 Google Scholar Authors : IK Budaraga BAB 2 ILMU SUSU ILMU PANGAN JILID 2, 15, 0 0 0000
507 Google Scholar Authors : RE Rachmanita, IK Budaraga, DE Rahmanto, MC Aprianto, S Pramudibyo, ... TEKNOLOGI ENERGI TERBARUKAN 0 0000
508 Google Scholar Authors : LO Nelwan, U Ahmad, R Hasbullah, IW Astika Proceedings of AESAP 2016 The 1 st International Conference on the Role of Agricultural Engineering for Sustainable Agriculture Production 0 0000
509 Google Scholar Authors : B Indonesia Unes Journal Mahasiswa Pertanian 0 0000
510 Google Scholar Authors : IK Budaraga, B Arnim, Yetti Marlida Antioxidant Properties of Liquid Smoke Production Variation of Pyrolysis Temperature Raw and Different Concentration International Journal of PharmTech Research 9 (6), 366-379, 0 17 0000
511 Google Scholar Authors : H Jantiko, IBK Suardana, KTP Gelgel Quick jump to page content 0 0000
512 Google Scholar Authors : I Ketut Budaraga, M Arnim Y., & Bulanin, U.(2016). Analysis of liquid smoke chemical components with GC MS from different raw materials variation production and pyrolysis temperaturelevel International Journal of ChemTech Research 9 (6), 694-708, 0 5 0000
513 Google Scholar Authors : IK Budaraga, YM Arnim Usman Bulanin,. 2016. Antioxidant Properties of Liquid Smoke Cinnamon Production of Variation Purification and Different Concentration International Journal of Scientific & Technology Research (IJSTR). ISSN ISSN …, 0 5 0000
514 Google Scholar Authors : IK Budaraga BAB 4 ILMU SAGU ILMU PANGAN JILID, 53, 0 0 0000
515 Google Scholar Authors : IK Budaraga, E Susanti Study of Toxicity of Cacao Skin Liquid (Theobroma cacao, L) Using BSLT Method (Brine Shrimp Lethality Test) 0 0000
516 Google Scholar Authors : B Indonesia Unes Journal Mahasiswa Pertanian 0 0000
517 Google Scholar Authors : IK Budaraga, B Arnim, Yetti Marlida Antioxidant Properties of Liquid Smoke Production Variation of Pyrolysis Temperature Raw and Different Concentration International Journal of PharmTech Research 9 (6), 366-379, 0 17 0000
518 Google Scholar Authors : RE Rachmanita, IK Budaraga, DE Rahmanto, MC Aprianto, S Pramudibyo, ... TEKNOLOGI ENERGI TERBARUKAN 0 0000
519 Scopus Creator : Budaraga I.K. Study of liquid smoke toxicity cocoa shell with different purification methods Iop Conference Series Earth and Environmental Science 1 Q3 as Conference Proceedin 2024
520 Scopus Creator : Budaraga I.K. Alginate addition from sargassum seaweed (Sargassum sp.) on pumpkin ice cream (cucurbita moschata durch.) characteristics Annals of Agri Bio Research 0 Q4 as Journal 2024
521 Scopus Creator : Budaraga I.K. Characteristics of Maco Fish (Leiognathidae Spelendes) Using Coconut Shell Liquid Smoke as A Natural Preservative Bio Web of Conferences 0 no-Q as Conference Proceedin 2023
522 Scopus Creator : Budaraga I.K. Study of determination of benzoic acid, ascorbic acid in food using high performance liquid chromatography (HPLC) method Aip Conference Proceedings 0 Q4 as Conference Proceedin 2023
523 Scopus Creator : Salihat R.A. The Effect of Addition of Wuluh Starfruit (Averrhoa bilimbi L.) Juice as a Coagulant in Cottage Cheese from Cow’s Milk Annals of Agri Bio Research 1 Q4 as Journal 2023
524 Scopus Creator : Budaraga I.K. The study of the utilization of wuluh starfruit (Averrhoa bilimbi L.) in cottage cheese from goat milk prepared with acidification method based on physicochemical properties and organoleptic evaluation Bulgarian Journal of Agricultural Science 2 Q3 as Journal 2023
525 Scopus Creator : Budaraga I.K. Acidification effects of starfruit (Averrhoa Bilimbi L.) on soy milk-based cottage cheese: A physicochemical and organoleptic assessment Potravinarstvo Slovak Journal of Food Sciences 3 Q3 as Journal 2023
526 Scopus Creator : Budaraga I.K. The quality characteristics of biscuits made with plantain and purple rice flour as substitutes for wheat flour Potravinarstvo Slovak Journal of Food Sciences 2 Q3 as Journal 2023
527 Scopus Creator : Budaraga I.K. Antioxidant Study of the Gambier Leaves By-Products into Tea with Red Ginger Powder Addition (Zingiber officinale Var. Rubrum) Aip Conference Proceedings 1 Q4 as Conference Proceedin 2023
528 Scopus Creator : Fitria E.A. The effect of wuluh starfruit (Averrhoa bilimbi L.) added on the physicochemical and antimicrobial characteristics of chitosan-PVA edible film Future of Food Journal on Food Agriculture and Society 3 Q3 as Journal 2023
529 Scopus Creator : Ketut Budaraga I. Heavy metals analysis (Cd, Pb, Zn, Cu, Cr) and calcium in Padang and Padang Panjang fresh cow's milk Iop Conference Series Earth and Environmental Science 3 Q4 as Conference Proceedin 2022
530 Scopus Creator : Budaraga I.K. Microbial activities and minimum liquid smoke killing concentration made of cacao pod toward Lasiodiplodia theobromae growth Iop Conference Series Earth and Environmental Science 1 Q4 as Conference Proceedin 2022
531 Scopus Creator : Budaraga I.K. Test liquid smoke toxicity for cocoa skin [Theobroma Cacao L.] with the BSLT method at different pyrolysis temperatures Iop Conference Series Earth and Environmental Science 1 Q4 as Conference Proceedin 2021
532 Scopus Creator : Budaraga I.K. The effect of material amount in distillation tank to chemical composition of citronella oil (Cymbopogon nardus L. Rendle) Iop Conference Series Earth and Environmental Science 2 Q4 as Conference Proceedin 2021
533 Scopus Creator : Ramaiyulis D.S. Potential and development of incubation technology to improve the quality of "dadih" as a specific food of minangkabau Livestock Research for Rural Development 1 Q3 as Journal 2021
534 Scopus Creator : Ketut Budaraga I. Analysis of metals (Pb, Mn, Cd, Zn, Cu) in Purple Rice and Purple Rice Stems Cultivated Organically using Biogas Slug in Padang Pariaman, West Sumatra Province Iop Conference Series Earth and Environmental Science 2 Q4 as Conference Proceedin 2021
535 Scopus Creator : Budaraga I.K. Antibacterial study of cocoa skin liquid smoke in raw milk Iop Conference Series Earth and Environmental Science 3 Q4 as Conference Proceedin 2021
536 Scopus Creator : Budaraga I.K. Quality of red tuna (Yellowfin tuna) fishball, white oyster mushroom (Pleurotus ostreatus) on different types of packaging and storage time Iop Conference Series Earth and Environmental Science 6 Q4 as Conference Proceedin 2021
537 Scopus Creator : Budaraga I.K. Analysis antioxidant IC50 liquid smoke of cocoa skin with several purification methods Iop Conference Series Earth and Environmental Science 11 Q4 as Conference Proceedin 2021
538 Scopus Creator : Ketut Budaraga I. Study of the physical properties of liquid smoke from cocoa rind on moisture content and different pyrolysis temperature Iop Conference Series Earth and Environmental Science 2 Q4 as Conference Proceedin 2020
539 Scopus Creator : Budaraga I.K. Study of Green Tea Catechin Dipped with Moringa Leaves Iop Conference Series Earth and Environmental Science 1 Q4 as Conference Proceedin 2020
540 Scopus Creator : Ketut Budaraga I. Study of the physical properties of liquid smoke from cocoa rind on moisture content and different pyrolysis temperature Iop Conference Series Earth and Environmental Science 2 Q4 as Conference Proceedin 2020
541 Scopus Creator : Budaraga I.K. Antioxidant Activity of ‘Broken Skin’ Purple Rice, ‘Skinned’ Purple Rice, and Purple Rice Stem Organically Cultivated in Indonesia International Journal on Advanced Science Engineering and Information Technology 6 Q2 as Journal 2020
542 Scopus Creator : Budaraga I.K. Liquid Smoke Antimicrobial Test of Cocoa Fruit Peel Against Eschericia Coli and Staphylococcus Aureus Bacteria Iop Conference Series Earth and Environmental Science 8 Q4 as Conference Proceedin 2019
543 Scopus Creator : Ketut Budaraga I. Influence of Liquid Smoke Cinnamon Against Attacks Leaf Rot Disease (Phytophthora Infestans) on Potato (Solanum Tuberosum L.) Iop Conference Series Earth and Environmental Science 2 Q4 as Conference Proceedin 2019
544 Scopus Creator : Budaraga I.K. Study of chemical components of liquid smoke from cocoa rind in two variations of moisture content by using GC-MS method Iop Conference Series Earth and Environmental Science 0 Q4 as Conference Proceedin 2019
545 Scopus Creator : Ketut Budaraga I. Liquid smoke toxicity properties of production of raw materials with variation of temperature and concentration of different International Journal of Chemtech Research 0 no-Q as Journal 2016
546 Scopus Creator : Budaraga K. Liquid smoke production quality from raw materials variation and different pyrolysis temperature International Journal on Advanced Science Engineering and Information Technology 43 Q4 as Journal 2016
547 Scopus Creator : Ketut Budaraga I. Analysis of liquid smoke chemical components with GC MS from different raw materials variation production and pyrolysis temperaturelevel International Journal of Chemtech Research 28 no-Q as Journal 2016
548 Scopus Creator : Ketut Budaraga I. Antioxidant properties of liquid smoke production variation of pyrolysis temperature raw and different concentration International Journal of Pharmtech Research 3 no-Q as Journal 2016
549 Google Scholar Authors : IK Budaraga Industri Pengolahan Daging CV HEI PUBLISHING INDONESIA, 2026 0 2026
550 Google Scholar Authors : IK Budaraga Industri Pengolahan Daging CV HEI PUBLISHING INDONESIA, 2026 0 2026
551 Google Scholar Authors : IK Budaraga Peranan Rumput Laut Dalam Formulasi Pengembangan Produk Pangan Fungsional Hei Publishing Indonesia, 2024 1 2024
552 Google Scholar Authors : ISHS diyah Mahbub Zuhri Novi Nur Lailisna Khairiah Fitra Azmi Siti Azizah ... Buku Filsafat Ilmu Dan Metode Ilmiah IN Patent EC00,202,439,778, 2024 0 2024
553 Google Scholar Authors : IK Budaraga Peranan Rumput Laut Dalam Formulasi Pengembangan Produk Pangan Fungsional Hei Publishing Indonesia, 2024 1 2024
554 Google Scholar Authors : IK Budaraga Peranan Rumput Laut Dalam Formulasi Pengembangan Produk Pangan Fungsional Hei Publishing Indonesia, 2024 1 2024
555 Google Scholar Authors : IK Budaraga, RA Salihat, EA Fitria The study of the utilization of wuluh starfruit (Averrhoa bilimbi L.) in cottage cheese from goat milk prepared with acidification method based on physicochemical … 1 2023
556 Google Scholar Authors : IK Budaraga, EA Fitria -Maize Nugget Making in Nagari Ladang Panjang, Pasaman Regency, West Sumatra: Pembuatan Nugget Jagung di Nagari Ladang Panjang, Kabupaten Pasaman, Sumatera Barat Dinamisia: Jurnal Pengabdian Kepada Masyarakat 7 (4), 1184-1189, 2023 1 2023
557 Google Scholar Authors : IK Budaraga, EA Fitria -Maize Nugget Making in Nagari Ladang Panjang, Pasaman Regency, West Sumatra: Pembuatan Nugget Jagung di Nagari Ladang Panjang, Kabupaten Pasaman, Sumatera Barat Dinamisia: Jurnal Pengabdian Kepada Masyarakat 7 (4), 1184-1189, 2023 1 2023
558 Google Scholar Authors : IK Budaraga, EA Fitria -Maize Nugget Making in Nagari Ladang Panjang, Pasaman Regency, West Sumatra: Pembuatan Nugget Jagung di Nagari Ladang Panjang, Kabupaten Pasaman, Sumatera Barat Dinamisia: Jurnal Pengabdian Kepada Masyarakat 7 (4), 1184-1189, 2023 1 2023
559 Google Scholar Authors : IKB Ni Luh Kartini Pertanian Terpadu Organik Sistem SabicaITaLA mendukung Ekonomi Berkelanjutan 0 2022
560 Google Scholar Authors : IKB Ni Luh Kartini Pertanian Terpadu Organik Sistem SabicaITaLA mendukung Ekonomi Berkelanjutan 0 2022
561 Google Scholar Authors : IKB Ni Luh Kartini Pertanian Terpadu Organik Sistem SabicaITaLA mendukung Ekonomi Berkelanjutan 0 2022
562 Google Scholar Authors : IK Budaraga, V Saibuma, L Hermalena Quality of red tuna (Yellowfin tuna) fishball, white oyster mushroom (Pleurotus ostreatus) on different types of packaging and storage time IOP Conference Series: Earth and Environmental Science 715 (1), 012068, 2021 9 2021
563 Google Scholar Authors : IK Budaraga, DP Putra Analysis antioxidant {IC} 50 liquid smoke of cocoa skin with several purification methods IOP Conf Ser. Earth Environ. Sci 757 (1), 12053, 2021 5 2021
564 Google Scholar Authors : IK Budaraga, V Saibuma, L Hermalena Quality of red tuna (Yellowfin tuna) fishball, white oyster mushroom (Pleurotus ostreatus) on different types of packaging and storage time IOP Conference Series: Earth and Environmental Science 715 (1), 012068, 2021 9 2021
565 Google Scholar Authors : IK Budaraga, V Saibuma, L Hermalena Quality of red tuna (Yellowfin tuna) fishball, white oyster mushroom (Pleurotus ostreatus) on different types of packaging and storage time IOP Conference Series: Earth and Environmental Science 715 (1), 012068, 2021 9 2021
566 Google Scholar Authors : IK Budaraga, DP Putra Analysis antioxidant {IC} 50 liquid smoke of cocoa skin with several purification methods IOP Conf Ser. Earth Environ. Sci 757 (1), 12053, 2021 5 2021
567 Google Scholar Authors : NL Kartini, IK Budaraga Pertanian Organik Penyelamat Kehidupan Deepublish, 2020 6 2020
568 Google Scholar Authors : C Wulandari, IK Budaraga, W Wellyalina, N Liamnimitr Proximate test and organoleptic test on the characteristics of the moringa layer CAKE Andalasian International Journal of Agriculture and Natural Sciences (AIJANS …, 2020 5 2020
569 Google Scholar Authors : NL Kartini, IK Budaraga Pertanian Organik Penyelamat Kehidupan Deepublish, 2020 6 2020
570 Google Scholar Authors : IK Budaraga, R Aga Salihat Study of chemical components of liquid smoke from cocoa rind in two variations of moisture content by using GC-MS method IOP Conference Series: Earth and Environmental Science 383 (1), 012023, 2019 0 2019
571 Google Scholar Authors : IK Budaraga, R Aga Salihat Study of chemical components of liquid smoke from cocoa rind in two variations of moisture content by using GC-MS method IOP Conference Series: Earth and Environmental Science 383 (1), 012023, 2019 0 2019
572 Google Scholar Authors : IK Budaraga, R Aga Salihat Study of chemical components of liquid smoke from cocoa rind in two variations of moisture content by using GC-MS method IOP Conference Series: Earth and Environmental Science 383 (1), 012023, 2019 0 2019
573 Google Scholar Authors : IK Budaraga Kajian Aktivitas Antioksidan, Tannin dan Kadar Air Teh Hijau Celup Akibat Penambahan Bubuk Jahe Merah (Zingiber officinale Rosc) UNES Journal of Agricultural Scienties 2 (1), 041-052, 2018 2 2018
574 Google Scholar Authors : IK Budaraga Kajian Aktivitas Antioksidan, Tannin dan Kadar Air Teh Hijau Celup Akibat Penambahan Bubuk Jahe Merah (Zingiber officinale Rosc) UNES Journal of Agricultural Scienties 2 (1), 041-052, 2018 2 2018
575 Google Scholar Authors : IK Budaraga Laporan penelitian: Kajian Mutu Fillet Lele Asap Yang Diberikan Asap Cair Kayu Manis 0 2018
576 Google Scholar Authors : IK Budaraga Buku Liquid Smoke Toxicity With Variation Of Temperature And Concentration 0 2018
577 Google Scholar Authors : IKB Gusriati 1), Armia2) ESTABLISHING ORGANIC RICE PRODUCTION: TECHNICAL, ECONOMIC AND SOCIAL CONSTRAINTS (Case Study on Organic Farmers in Nagari Sariek Alahan... UNES Journal Agricultural Scienties 1 (2), 167-175 0 2017
578 Google Scholar Authors : IK Budaraga, W Winda, D Prima Putra Study about Some Quality of Green Tea Ground with Addition of Red Ginger Powder (Zingiber Officinale Rosc) International Journal of Life Sciences Research 5 (3), 8-17, 2017 0 2017
579 Google Scholar Authors : IK Budaraga Rice Intelligent From Making Mocaf (Modified Cassava Flour) Universitas Ekasakti Padang (International Conference on Global Education V …, 2017 0 2017
580 Google Scholar Authors : IK Budaraga, W Winda, D Prima Putra Study about Some Quality of Green Tea Ground with Addition of Red Ginger Powder (Zingiber Officinale Rosc) International Journal of Life Sciences Research 5 (3), 8-17, 2017 0 2017
581 Google Scholar Authors : IK Budaraga Effect of Combination Treatment of Liquid Smoke Concentration, Soaking Time, Packaging and Different Storage Time To Yield And Moisture Contentnila Fish Fillet (Oreochromis niloticus) International Journal of ChemTech Research 10 (Vol.10 No.1 pp 77-88, 2017 ... 0 2017
582 Google Scholar Authors : IK Budaraga Effect of Combination Treatment of Concentration Liquid Smoke, Immertion Duration, Packaging and old Type Storagedifferent Levels of Protein Nila Fish Fillet 3 2017
583 Google Scholar Authors : IK Budaraga, W Winda, D Prima Putra Study about Some Quality of Green Tea Ground with Addition of Red Ginger Powder (Zingiber Officinale Rosc) International Journal of Life Sciences Research 5 (3), 8-17, 2017 0 2017
584 Google Scholar Authors : G Gusriati, A Armia, IK Budaraga MEMBANGUN PRODUKSI PADI ORGANIK: KENDALA TEKNIS, EKONOMIS DAN SOSIAL (Studi Kasus pada Petani Organic di Nagari Sariek Alahan Tigo Kecamatan Hiliran Gumanti Kabupaten Solok) Unes Journal of Agricultural Scienties 1 (2), 167-175 0 2017
585 Google Scholar Authors : G Gusriati, A Armia, IK Budaraga MEMBANGUN PRODUKSI PADI ORGANIK: KENDALA TEKNIS, EKONOMIS DAN SOSIAL (Studi Kasus pada Petani Organic di Nagari Sariek Alahan Tigo Kecamatan Hiliran Gumanti Kabupaten Solok) Unes Journal of Agricultural Scienties 1 (2), 167-175 0 2017
586 Google Scholar Authors : IK Budaraga, A Arnim, Y Marlinda, U Bulain Liquid smoke production quality from raw materials variation and different pyrolysis temperature International Journal on Advanced Science, Engineering and Information …, 2016 87 2016
587 Google Scholar Authors : Z I Ketut Budaraga,Fridarti, Salamanang Pembuatan Pakan Ternak Sapi dari Jerami menggunakan Ramuan Organik Ternak (ROTER) sebagai salah satu perwujudan kegiatan KKN-PPM Pertanian Terinte... Politeknik Pertanian Negeri Pertanian Payakumbuh 1, 177-198 0 2016
588 Google Scholar Authors : IK Budaraga, A Arnim, Y Marlinda, U Bulain Liquid smoke production quality from raw materials variation and different pyrolysis temperature International Journal on Advanced Science, Engineering and Information …, 2016 87 2016
589 Google Scholar Authors : IK Budaraga, A Arnim, Y Marlida, U Bulanin Liquid smoke toxicity characteristic from raw materials variation production with different temperature and concentration level. 0 2016
590 Google Scholar Authors : Z I Ketut Budaraga,Fridarti, Salamanang Pembuatan Pakan Ternak Sapi dari Jerami menggunakan Ramuan Organik Ternak (ROTER) sebagai salah satu perwujudan kegiatan KKN-PPM Pertanian Terintegrasi di Kanagarian Kasang … Politeknik Pertanian Negeri Pertanian Payakumbuh 1, 177-198 0 2016
591 Google Scholar Authors : Y I Ketut Budaraga Penerapan Iptek Bagi Masyarakat bagi Petani Tebu dan Sarunai Maimbau Di Korong Batang Selasih Kanagarian Bukit Batabuah Kecamatan Canduang Kabupaten... Menara ilmu 220 (Vol 9 j. 1 No.62 Okt 2015 ISSN 1693-2617), 190-205 0 2015
592 Google Scholar Authors : Y I Ketut Budaraga Penerapan Iptek Bagi Masyarakat bagi Petani Tebu dan Sarunai Maimbau Di Korong Batang Selasih Kanagarian Bukit Batabuah Kecamatan Canduang Kabupaten... Menara ilmu 220 (Vol 9 j. 1 No.62 Okt 2015 ISSN 1693-2617), 190-205 0 2015
593 Google Scholar Authors : G I Ketut Budaraga Kajian Mutu Mikrobiologi Filet Lele Asap yang diberi Asap Cair Kayu Manis Ekasakti 143 (Vol.24.no.1 Januari 2014 ISSN 0854-8099), 92-108, 2014 0 2014
594 Google Scholar Authors : IK Budaraga Utilization Using Liquid Smoke Fish Fillet AsPservatives International seminar global education 2 786 (Proceeding UNES dan UKM), 1-19, 2014 0 2014
595 Google Scholar Authors : G I Ketut Budaraga Kajian Mutu Mikrobiologi Filet Lele Asap yang diberi Asap Cair Kayu Manis Ekasakti 143 (Vol.24.no.1 Januari 2014 ISSN 0854-8099), 92-108, 2014 0 2014
596 Google Scholar Authors : IKB dan gusriati Kajian efek antioksidan asap cair kayu manis untuk menghambat oksidasi lemak pada filet ikan nila (oriochromis nilotica) asap selama penyimpanan pada suhu ka... Ekotrans 214 (Volume.12 No. 1 Januari 2012), 191-214 0 2012
597 Google Scholar Authors : UB I Ketut Budaraga, Arnim, Yetti Marlida Uji Kinerja Alat dan Identifikasi Produk AsaCair Kayu Manis Pada Berbagai Waktu Pirolisis dan Cara Pemurnian Untuk Pengawet Filet Ikan Nila Ekasakti 20 (1), 137-165, 2011 0 2011
598 Google Scholar Authors : G I Ketut Budaraga,Rizal Abu Inovation Cocunut Shell Briquette Production Stove As Alternative Substitution of Fuel Oil In Pariaman Ekotrans 189 (Vol 11 No.1.Jan 2011 ISSN 1411-4615), 189, 2011 0 2011
599 Google Scholar Authors : IK Budaraga, YM Arnim Usman Bulanin,. 2016. Antibacterial Properties of Liquid Smoke from the Production of Cinnamon How Purification and Concentration of Different International Journal of Thesis Projects and Dissertations (IJTPD) Vol 4 …, 0 5 0000
600 Google Scholar Authors : IK Budaraga, YM Arnim Usman Bulanin,. 2016. Antibacterial Properties of Liquid Smoke from the Production of Cinnamon How Purification and Concentration of Different International Journal of Thesis Projects and Dissertations (IJTPD) Vol 4 …, 0 5 0000
601 Penelitian Jusmita Weriza; I Ketut Budaraga; Rosnita Rauf PERANCANGAN SISTEM INFORMASI LOMBA PADANG KELOLA SAMPAH DENGAN METODE UNIFIED MODELING LANGUAGE (UML) INSTITUSI INTERNAL ( PI )
Leader: Harry Setya Hadi
Sumber: INTERNAL SOURCE
Status: Approved
Dana: Rp10.000.000
2025
602 Penelitian Merry Thressia; I Ketut Budaraga Studi Analisa Pembangkit Listrik Tenaga Hibrid PLTM Sako dan listrik PT.PLN(Persero) Rayo Balai Selasa Kabupaten Pesisir Selatan, Sumatera Barat Penelitian Kompetitif Nasional ( PFR )
Leader: Rosnita Rauf
Sumber: BIMA SOURCE
Status: Approved
Dana: Rp104.310.000
2024
603 Penelitian Rera Aga Salihat; Eddwina Aidila Fitria Pemanfaatan Belimbing Wuluh (Averrhoa bilimbi L.) dalam Pembuatan Keju Lunak (Soft Cheese) dengan Metode Asam Penelitian Kompetitif Nasional ( PDKN )
Leader: I Ketut Budaraga
Sumber: BIMA SOURCE
Status: Approved
Dana: Rp145.430.000
2023
604 Penelitian Rera Aga Salihat; Eddwina Aidila Fitria Pemanfaatan Belimbing Wuluh (Averrhoa bilimbi L.) dalam Pembuatan Keju Lunak (Soft Cheese) dengan Metode Asam Penelitian Kompetitif Nasional ( PDKN )
Leader: I Ketut Budaraga
Sumber: BIMA SOURCE
Status: Approved
Dana: Rp138.100.000
2022
605 Penelitian - Kajian Pemanfaatan Asap Cair dari Limbah Kulit Buah Coklat Sebagai Bahan Pengawet Susu Segar Penelitian Kompetitif Nasional ( PT )
Leader: I Ketut Budaraga
Sumber: SIMLITABMAS SOURCE
Status: Approved
Dana: Rp156.673.070
2021
606 Penelitian - Kajian Pemanfaatan Asap Cair dari Limbah Kulit Buah Coklat Sebagai Bahan Pengawet Susu Segar Penelitian Kompetitif Nasional ( PT )
Leader: I Ketut Budaraga
Sumber: SIMLITABMAS SOURCE
Status: Approved
Dana: Rp163.341.570
2020
607 Penelitian I Ketut Budaraga; Ivonne Ayesha; Nofrita Sandi Model dan Teknik Pengaturan suhu kelembaban otomatis pada kumbung Jamur Tiram menggunakan Digital Skylite. Penelitian Kompetitif Nasional ( PKPT )
Leader: Ananto
Sumber: SIMLITABMAS SOURCE
Status: Approved
Dana: Rp63.555.000
2020
608 Penelitian - Kajian Pemanfaatan Asap Cair dari Limbah Kulit Buah Coklat Sebagai Bahan Pengawet Susu Segar Penelitian Kompetitif Nasional ( PT )
Leader: I Ketut Budaraga
Sumber: BIMA SOURCE
Status: Approved
Dana: Rp140.288.000
2019
609 Penelitian I Ketut Budaraga; Ivonne Ayesha; Nofrita Sandi Model dan Teknik Pengaturan suhu kelembaban otomatis pada kumbung Jamur Tiram menggunakan Digital Skylite. Penelitian Kompetitif Nasional ( PKPT )
Leader: Ananto
Sumber: SIMLITABMAS SOURCE
Status: Approved
Dana: Rp65.155.000
2019
610 Penelitian Gusriati Kajian Mutu Fillet Lele Asap yang Diberikan Asap Cair Kayu Manis Penelitian Kompetitif Nasional ( PPT/Produk Terapan )
Leader: I Ketut Budaraga
Sumber: BIMA SOURCE
Status: Approved
Dana: Rp50.000.000
2013
611 Pengabdian Fridarti PENERAPAN PERTANIANTERINTEGRASI UNTUK PENINGKATAN PENDAPATAN PETANI DALAM RANGKA MEWUJUDKAN KETAHANAN PANGAN DI NAGARI KASANG KECAMATAN BATANG ANAI KABUPATEN PADANG PARIAMAN Pengabdian Kepada Masyarakat Kompetitif Nasional ( KKN-PPM )
Leader: I Ketut Budaraga
Sumber: SIMLITABMAS SOURCE
Status: Approved
Dana: Rp62.500.000
2016
612 Pengabdian Yurnalis IbM KELOMPOK TANI TEBU SIRANGKAK GADANG DAN SARUNAI MAIMBAU Pengabdian Kepada Masyarakat Kompetitif Nasional ( PKM )
Leader: I Ketut Budaraga
Sumber: BIMA SOURCE
Status: Approved
Dana: Rp42.500.000
2015
613 Pengabdian Prima Novia IbM KELOMPOK ORGANISASI PADAT KARYA 4 SAJAREK Pengabdian Kepada Masyarakat Kompetitif Nasional ( PKM )
Leader: I Ketut Budaraga
Sumber: SIMLITABMAS SOURCE
Status: Approved
Dana: Rp48.000.000
2014
614 Pengabdian I Ketut Budaraga PENINGKATAN PENDAPATAN MASYARAKAT MELALUI PEMANFAATAN BRIKET TEMPURUNG KELAPA,KOMPOR BRIKET DAN ASAP CAIR DI DESA SUNGAI RAMBAI KECAMATAN PARIAMAN UTARA KOTA PARIAMAN PROVINSI SUMATERA BARAT Pengabdian Kepada Masyarakat Kompetitif Nasional ( KKN-PPM )
Leader: Risal Abu
Sumber: SIMLITABMAS SOURCE
Status: Approved
Dana: Rp60.000.000
2014
615 Pengabdian I Ketut Budaraga PENINGKATAN PRODUKSI TANAMAN KAKAO MELALAUI PEMANFAATAN ASAP CAIR TEMPURUNG KELAPA DAN PUPUK ORGANIK DI NAGARI SUNGAI BULUH KECAMATAN BATANG ANAI KABUPATEN PADANG PARIAMAN PROVINSI SUMATERA BARAT Pengabdian Kepada Masyarakat Kompetitif Nasional ( KKN-PPM )
Leader: Gusriati
Sumber: BIMA SOURCE
Status: Approved
Dana: Rp60.000.000
2013
616 Pengabdian - Kelompok Tani Tagamang Bajawek di Padang Pariaman Sumbar Pengabdian Kepada Masyarakat Kompetitif Nasional ( PKM )
Leader: I Ketut Budaraga
Sumber: BIMA SOURCE
Status: Approved
Dana: Rp45.000.000
2013
617 IPRs LPPM Universitas Ekasakti dan Dinas Lingkungan Hidup Kota Padang Buku panduan lomba Padang Rancak Award EC002025164743 2025
618 IPRs I Ketut Budaraga POSTHARVEST PHYSIOLOGY AND TECHNOLOGY BASED ON OBE EC002025158012 2025
619 IPRs LPPM Universitas Ekasakti dan Dinas Lingkungan Hidup Kota Padang Program komputer sistem lomba Padang Rancak Award EC002025164740 2025
620 IPRs I Ketut Budaraga, Rera Aga Salihat,Eddwina Aidila Fitria TEKNOLOGI DAN KARAKTERISTIK KEJU LUNAK :PRODUKSI, MUTU DAN INOVASI EC002025119777 2025
621 IPRs Helena Tatcher Pakpahan Siti Kurniasih D. Yadi Heryadi Anna Fauziah Andi Primafira Bumandava Eka M. Irwan Tahir Qurnia Andayani Ahmad Fachri Eko Sumartono I Ketut Budaraga Konsep Pemberdayaan Masyarakat EC00202449833 2024
622 IPRs Khairiah, Ropiudin, Pande Putu Indira Prima Dewi, Ni Made Suaniti, Andi Abdul Halik Lateko, Wayan Budiarsa Suyasa, Wenny Surya Murtius, Kavadya Syska, I Ketut Budaraga, Ketut Gede Dharma Putra Rekayasa Bioenergi EC002024216698 2024
623 IPRs Rahmawati, Dessy Eka Kuliahsari, Erna Rusliana Muhamad Saleh, Destiana Adinda Putri, Agustia Dwi Pamujiati, Nurhayati, Endah Puspitojati, Emi Kurniawati, Husnita Komalasari, Ramadhani Chaniago, Putu Tessa Fadhila, Yani Subaktilah, Siti Nurha Teknologi Pengolahan Dan Hasil Pertanian EC00202442132 2024
624 IPRs Sarifah Nurjanah, Kavadya Syska, Nurud Diniyah, I Ketut Budaraga , Gusti Setiavani, Endang Verawati Teknologi tepat guna dan teknologi terapan EC002024202092 2024
625 IPRs Sugiarti, Devi Kumala Sari, Debby Syukriani, Engki Zelpina, Nelzi, Fati Nilawati, Ahmad Muchlis, I Wayan Sulendre, Syarifuddin, I Ketut Budaraga Ilmu Teknologi Hasil Ternak EC00202478176 2024
626 IPRs I Ketut Budaraga, Andy Amiruddin PERANAN TEKNOLOGI PENGOLAHAN DAN PENGAWETAN PANGAN BERBASIS SUMBER DAYA DAN KEARIFAN LOKAL UNTUK MEWUJUDKAN PANGAN SEHAT EC00202420497 2024
627 IPRs Sarifah Nurjanah, Kavadya Syska, Nurud Diniyah, I Ketut Budaraga , Gusti Setiavani, Endang Verawati Teknologi tepat guna dan teknologi terapan EC002024202092 2024
628 IPRs Rahmawati, Dessy Eka Kuliahsari, Erna Rusliana Muhamad Saleh, Destiana Adinda Putri, Agustia Dwi Pamujiati, Nurhayati, Endah Puspitojati, Emi Kurniawati, Husnita Komalasari, Ramadhani Chaniago, Putu Tessa Fadhila, Yani Subaktilah, Siti Nurha Teknologi Pengolahan Dan Hasil Pertanian EC00202442132 2024
629 IPRs Sugiarti, Devi Kumala Sari, Debby Syukriani, Engki Zelpina, Nelzi, Fati Nilawati, Ahmad Muchlis, I Wayan Sulendre, Syarifuddin, I Ketut Budaraga Ilmu Teknologi Hasil Ternak EC00202478176 2024
630 IPRs I Ketut Budaraga, Andy Amiruddin PERANAN TEKNOLOGI PENGOLAHAN DAN PENGAWETAN PANGAN BERBASIS SUMBER DAYA DAN KEARIFAN LOKAL UNTUK MEWUJUDKAN PANGAN SEHAT EC00202420497 2024
631 IPRs Rahmadina, I Ketut Budaraga, Endang Verawati, Devi Bunga Pagalla, Irman Irawan, Arina Fatharani, Rahmawati Fisiologi Pascapanen EC002024256317 2024
632 IPRs Muhammad Iqbal Fanani Gunawan, Andini Putri Riandani, Erna Rusliana Muhamad Saleh, Indah Rodianawati, I Ketut Budaraga, Sri Surani, Syarifa Ramadhani Nurbaya, Santi Dwi Astuti, Nurhayati, Zalfadhiyaa Naufal Fayyadh Teknik Evaluasi Sensori Produk Pangan EC00202445806 2024
633 IPRs Nurhayati, Chatarina Lilis Suryani, Usman Pato dkk Pengembangan Pangan Fungsional EC00202457007 2024
634 IPRs Ropiudin, Rusman, Risse Entikaria Rachmanita, I Ketut Budaraga, Dedy Eko Rahmanto, Muchammad Chusnan Aprianto, Sugeng Pramudibyo, Dion Eko Prihandono Teknologi Energi Terbarukan EC002024194190 2024
635 IPRs Indrawaty Sitepu, Halimatus Sa’diyah, Mahbub Zuhri, Novi Nur Lailisna, Khairiah, Fitra, Azmi, Siti Azizah, Erlinda Yurisinthae, I Ketut Budaraga Filsafat Ilmu dan Metode Ilmiah EC00202439778 2024
636 IPRs I Ketut Budaraga, Mac Aditiawarman, Andy Amiruddin, Hary Fandeli, Wawan Sumarno, Rera Agung Syukra TEKNOLOGI PENGOLAHAN KELAPA TERPADU BESERTA BERBAGAI TUTORIAL PENGOLAHAN POHON KELAPA EC00202470953 2024
637 IPRs Muhammad Iqbal Fanani Gunawan, Andini Putri Riandani, Erna Rusliana Muhamad Saleh, Indah Rodianawati, I Ketut Budaraga, Sri Surani, Syarifa Ramadhani Nurbaya, Santi Dwi Astuti, Nurhayati, Zalfadhiyaa Naufal Fayyadh Teknik Evaluasi Sensori Produk Pangan EC00202445806 2024
638 IPRs Nurhayati, Chatarina Lilis Suryani, Usman Pato dkk Pengembangan Pangan Fungsional EC00202457007 2024
639 IPRs LPPM Universitas Ekasakti FORMULASI EDIBLE FILM DENGAN PENAMBAHAN BELIMBING WULUH (Averrhoa Bilimbi L.) S00202309391 2023
640 IPRs LPPM Universitas Ekasakti ALAT PEMBUAT ASAP CAIR DENGAN SISTEM VAKUM S00202213155 2022
641 IPRs LPPM Universitas Ekasakti KEJU COTTAGE DARI SUSU SAPI DENGAN PENAMBAHAN BELIMBING WULUH S00202213154 2022
642 IPRs LPPM Universitas Ekasakti PROSES PEMBUATAN ASAP CAIR DENGAN SISTEM VAKUM S00202213156 2022
643 IPRs I Ketut Budaraga Buku Liquid Smoke Toxicity With Variation Of Temperature And Concentration 000129575 2018
644 IPRs I Ketut Budaraga Disertasi:Potensi Asap Cair Dari Berbagai Sumber Dan Aplikasinya Sebagai Pengawet Fillet Ikan Nila (Oreochromis Nilotica) 000109419 2018
645 IPRs I Ketut Budaraga,yossi oktavia Kajian Mutu Minuman Segar Corens Dengan Penggunaan Berbagai Jenis Jeruk 000129574 2018
646 IPRs I Ketut Budaraga Laporan penelitian: Kajian Mutu Fillet Lele Asap Yang Diberikan Asap Cair Kayu Manis 000109449 2018
647 IPRs LPPM Universitas Ekasakti KOMPOR BRIKET TAHAN PANAS S00201000249 2010
648 Buku Parwito, Loso Judianto,Alce Ilona Noya, I Ketut Budaraga Transportasi Pertanian: Kolaborasi Untuk Ketahanan Pangan CV Lauk Puyu Press 2025
649 Buku Parwito, Loso Judianto,Alce Ilona Noya, I Ketut Budaraga POSTHARVEST PHYSIOLOGY AND TECHNOLOGY BASED ON OBE CV Lauk Puyu Press 2025
650 Buku Parwito, Loso Judianto,Alce Ilona Noya, I Ketut Budaraga Teknologi dan karakteristik keju lunak : produksi, mutu, dan inovasi CV Lauk Puyu Press 2025
651 Buku Parwito, Loso Judianto,Alce Ilona Noya, I Ketut Budaraga Ilmu Pangan Jilid 1 CV Lauk Puyu Press 2025
652 Buku Parwito, Loso Judianto,Alce Ilona Noya, I Ketut Budaraga TEKNOLOGI PENGOLAHAN KELAPA TERPADU BESERTA BERBAGAI TUTORIAL PENGOLAHAN POHON KELAPA CV Lauk Puyu Press 2025
653 Buku Parwito, Loso Judianto,Alce Ilona Noya, I Ketut Budaraga Filsafat Ilmu dan Metode Ilmiah CV Lauk Puyu Press 2025
654 Buku Parwito, Loso Judianto,Alce Ilona Noya, I Ketut Budaraga Pengembangan pangan fungsional CV Lauk Puyu Press 2025
655 Buku Parwito, Loso Judianto,Alce Ilona Noya, I Ketut Budaraga Ilmu Teknologi Hasil Ternak CV Lauk Puyu Press 2025
656 Buku Parwito, Loso Judianto,Alce Ilona Noya, I Ketut Budaraga TEKNOLOGI PENGOLAHAN DAN HASIL PERTANIAN CV Lauk Puyu Press 2025
657 Buku Parwito, Loso Judianto,Alce Ilona Noya, I Ketut Budaraga Rekayasa Bioenergi CV Lauk Puyu Press 2025
658 Buku I Ketut Budaraga, Andy Amiruddin PERANAN TEKNOLOGI PENGOLAHAN DAN PENGAWETAN PANGAN BERBASIS SUMBER DAYA DAN KEARIFAN LOKAL UNTUK MEWUJUDKAN PANGAN SEHAT CV HEI PUBLISHING INDONESIA 2024
659 Buku I Ketut Budaraga, Andy Amiruddin Fisiologi Pascapanen CV HEI PUBLISHING INDONESIA 2024
660 Buku I Ketut Budaraga, Andy Amiruddin Teknologi Tepat Guna dan Teknologi Terapan CV HEI PUBLISHING INDONESIA 2024
661 Buku I Ketut Budaraga, Andy Amiruddin Konsep Pemberdayaan Masyarakat CV HEI PUBLISHING INDONESIA 2024
662 Buku I Ketut Budaraga, Andy Amiruddin Keamanan Pangan CV HEI PUBLISHING INDONESIA 2024
663 Buku I Ketut Budaraga, Andy Amiruddin Ilmu Pangan Jilid 1 CV HEI PUBLISHING INDONESIA 2024
664 Buku I Ketut Budaraga, Andy Amiruddin TEKNOLOGI PENGOLAHAN KELAPA TERPADU BESERTA BERBAGAI TUTORIAL PENGOLAHAN POHON KELAPA CV HEI PUBLISHING INDONESIA 2024
665 Buku I Ketut Budaraga, Andy Amiruddin Filsafat Ilmu dan Metode Ilmiah CV HEI PUBLISHING INDONESIA 2024
666 Buku I Ketut Budaraga, Andy Amiruddin Pengembangan pangan fungsional CV HEI PUBLISHING INDONESIA 2024
667 Buku I Ketut Budaraga, Andy Amiruddin Teknologi Pengolahan Hasil Perkebunan CV HEI PUBLISHING INDONESIA 2024
668 Buku Anna Permatasari Kamarudin, Eko Sutrisno, Suwari Akhmaddhian, Eka Wisdawati, Sama' Iradat Tito, Parwiyanti, Mohammad Mardiyanto, I Ketut Budaraga, Nurhayati Ketahanan Pangan dan Kearifan Lokal Perkumpulan Rumah Cemerlang Indonesia 2023
669 Buku Anna Permatasari Kamarudin, Eko Sutrisno, Suwari Akhmaddhian, Eka Wisdawati, Sama' Iradat Tito, Parwiyanti, Mohammad Mardiyanto, I Ketut Budaraga, Nurhayati Pertanian terpadu organik sistem sabicaitala mendukung ekonomi berkelanjutan Perkumpulan Rumah Cemerlang Indonesia 2023
670 Buku Anna Permatasari Kamarudin, Eko Sutrisno, Suwari Akhmaddhian, Eka Wisdawati, Sama' Iradat Tito, Parwiyanti, Mohammad Mardiyanto, I Ketut Budaraga, Nurhayati Pertanian organik penyelamat kehidupan Perkumpulan Rumah Cemerlang Indonesia 2023
671 Buku Anna Permatasari Kamarudin, Eko Sutrisno, Suwari Akhmaddhian, Eka Wisdawati, Sama' Iradat Tito, Parwiyanti, Mohammad Mardiyanto, I Ketut Budaraga, Nurhayati Buku manual cara membuat asap cair dari kulit buah kakao dan aplikasi sebagai pestisida tanaman kakao Perkumpulan Rumah Cemerlang Indonesia 2023
672 Buku Anna Permatasari Kamarudin, Eko Sutrisno, Suwari Akhmaddhian, Eka Wisdawati, Sama' Iradat Tito, Parwiyanti, Mohammad Mardiyanto, I Ketut Budaraga, Nurhayati Liquid Smoke Toxicity With Variation Of Temperature And Concentration Perkumpulan Rumah Cemerlang Indonesia 2023
673 Buku Prof.Dr.Ir. I Ketut Budaraga,MSi.CIRR/Editor: Eddy Jajang Jaya Atmaja Teknologi Pengolahan Rumput Laut Mawadra Lestari Enterprise 2025
674 Buku Prof.Dr.Ir. I Ketut Budaraga,MSi.CIRR/Editor: Eddy Jajang Jaya Atmaja Ilmu Pangan (Jilid 2) Mawadra Lestari Enterprise 2025
675 Buku Prof.Dr.Ir. I Ketut Budaraga,MSi.CIRR/Editor: Eddy Jajang Jaya Atmaja Teknologi Energi Terbarukan Mawadra Lestari Enterprise 2025
676 Buku Prof.Dr.Ir. I Ketut Budaraga,MSi.CIRR/Editor: Eddy Jajang Jaya Atmaja TEKNIK EVALUASI SENSORI PRODUK PANGAN Mawadra Lestari Enterprise 2025
677 Buku Indrawaty Sitepu, Halimatus Sa'diyah, Mahbub Zuhri , NOVI NUR LAILISNA, Khairiah,Fitra, Azmi, Siti Azizah, Erlinda Yurisinthae, I Ketut Budaraga Teknologi Pengolahan Rumput Laut CV HEI PUBLISHING INDONESIA 2024
678 Buku Indrawaty Sitepu, Halimatus Sa'diyah, Mahbub Zuhri , NOVI NUR LAILISNA, Khairiah,Fitra, Azmi, Siti Azizah, Erlinda Yurisinthae, I Ketut Budaraga Ilmu Pangan (Jilid 2) CV HEI PUBLISHING INDONESIA 2024
679 Buku Indrawaty Sitepu, Halimatus Sa'diyah, Mahbub Zuhri , NOVI NUR LAILISNA, Khairiah,Fitra, Azmi, Siti Azizah, Erlinda Yurisinthae, I Ketut Budaraga Teknologi Energi Terbarukan CV HEI PUBLISHING INDONESIA 2024
680 Buku Indrawaty Sitepu, Halimatus Sa'diyah, Mahbub Zuhri , NOVI NUR LAILISNA, Khairiah,Fitra, Azmi, Siti Azizah, Erlinda Yurisinthae, I Ketut Budaraga TEKNIK EVALUASI SENSORI PRODUK PANGAN CV HEI PUBLISHING INDONESIA 2024
681 IPRs Anna Permatasari Kamarudin, Eko Sutrisno, Suwari Akhmaddhian, Eka Wisdawati, Sama' Iradat Tito, Parwiyanti, Mohammad Mardiyanto, I Ketut Budaraga, Nurhayati Ketahanan Pangan dan Kearifan lokal EC00202403134 2024
682 IPRs Nurhayati I Ketut Budaraga Nurul Fajrih H. Soraya Kusuma Putri Juni Sumarmono Rahmaniar Rifda Naufalin Santi Dwi Astuti Sri Widowati Ilmu Pangan Jilid 2 EC002024221093 2024
683 IPRs Nurhayati, Sri Widowati, Cynthia Gracia Christina Lopulalan, I Ketut Budaraga, Erismar Amri , Chatarina Lilis Suryani, Santi Dwi Astuti , Herlina, Nurma Handayani ,Edi Susilo ILMU PANGAN JILID 1 EC002024212346 2024
684 IPRs Nurhayati I Ketut Budaraga Nurul Fajrih H. Soraya Kusuma Putri Juni Sumarmono Rahmaniar Rifda Naufalin Santi Dwi Astuti Sri Widowati Ilmu Pangan Jilid 2 EC002024221093 2024
685 Google Scholar Authors : S I Ketut Budaraga1,*, Eddwina Aidila Fitria1 Identification of Salmonella SP on Food Preparations (Seasoning and Rakik Chips) in Padang City Proceeding 2nd International Conference Khairun University (IConKU) 2024 1 …, 2024 0 2024
686 Google Scholar Authors : IK Budaraga Sifat Fungsional Asam LEmak Trans Hei Publishing Indonesia, 2024 0 2024
687 Google Scholar Authors : S I Ketut Budaraga1,*, Eddwina Aidila Fitria1 Identification of Salmonella SP on Food Preparations (Seasoning and Rakik Chips) in Padang City Proceeding 2nd International Conference Khairun University (IConKU) 2024 1 …, 2024 0 2024
688 Google Scholar Authors : IK Budaraga Peranan Teknologi Pengolahan Dan Pengawetan Pangan Berbasis Sumber Daya Dan Kearifan Lokal Untuk Mewujudkan Pangan Sehat Hei Publishing Indonesia, 2024 0 2024
689 Google Scholar Authors : MIF Gunawan, AP Riandani, ERM Saleh, I Rodianawati, IK Budaraga, ... Teknik evaluasi sensori pangan CV Hei Publishing Indonesia, 2024 6 2024
690 Google Scholar Authors : IK Budaraga Sifat Fungsional Asam LEmak Trans Hei Publishing Indonesia, 2024 0 2024
691 Google Scholar Authors : IK Budaraga Sifat Fungsional Asam LEmak Trans Hei Publishing Indonesia, 2024 0 2024
692 Google Scholar Authors : S I Ketut Budaraga1,*, Eddwina Aidila Fitria1 Identification of Salmonella SP on Food Preparations (Seasoning and Rakik Chips) in Padang City Proceeding 2nd International Conference Khairun University (IConKU) 2024 1 …, 2024 0 2024
693 Google Scholar Authors : IK Budaraga Peranan Teknologi Pengolahan Dan Pengawetan Pangan Berbasis Sumber Daya Dan Kearifan Lokal Untuk Mewujudkan Pangan Sehat Hei Publishing Indonesia, 2024 0 2024
694 Google Scholar Authors : IK Budaraga, RA Salihat, EA Fitria Acidification effects of starfruit (Averrhoa Bilimbi L.) on soy milk-based cottage cheese: A physicochemical and organoleptic assessment. Slovak Journal of Food Sciences 17, 2023 6 2023
695 Google Scholar Authors : IK Budaraga, RA Salihat, EA Fitria Acidification effects of starfruit (Averrhoa Bilimbi L.) on soy milk-based cottage cheese: A physicochemical and organoleptic assessment. Potravinarstvo Slovak Journal of Food Sciences 17, 986-996, 2023 6 2023
696 Google Scholar Authors : IK Budaraga, WS Devi ‘Penguatan Ketahanan Masyarakat dalam Menghadapi Era New Normal melalui Penerapan Teknologi Tepat Guna Bidang Pertanian’Potensi Budidaya Tanaman Hias di Kelompok Wanita Tani … Semin. Nas. Pengabdi 1 (1), 59-65, 2021 1 2021
697 Google Scholar Authors : NY I Ketut Budaraga Study of Escherichia coliand Salmonella sp. bacterial contamination from meatball seller on Bandar Buat market in Padang City Journal of Tropical Industrial Agriculture and Rural Development 1 (2), 52-56, 2021 0 2021
698 Google Scholar Authors : IK Budaraga, RA Salihat Antioxidant Activity of ‘Broken Skin’ Purple Rice, ‘Skinned’ Purple Rice, and Purple Rice Stem Organically Cultivated in Indonesia International Journal on Advanced Science, Engineering and Information …, 2020 6 2020
699 Google Scholar Authors : IK Budaraga, RA Salihat Antioxidant Activity of ‘Broken Skin’ Purple Rice, ‘Skinned’ Purple Rice, and Purple Rice Stem Organically Cultivated in Indonesia International Journal on Advanced Science, Engineering and Information …, 2020 6 2020
700 Google Scholar Authors : IK Budaraga Effect of Combination Treatment of Liquid Smoke Concentration, Soaking Time, Packaging and Different Storage Time To Yield And Moisture Contentnila Fish Fillet (... International Journal of ChemTech Research 10 (Vol.10 No.1 pp 77-88, 2017 … 1 2017
701 Google Scholar Authors : IK Budaraga Effect of Combination Treatment of Liquid Smoke Concentration, Soaking Time, Packaging and Different Storage Time To Yield And Moisture Contentnila Fish Fillet (... International Journal of ChemTech Research 10 (Vol.10 No.1 pp 77-88, 2017 … 1 2017
702 Google Scholar Authors : IK Budaraga Effect of Combination Treatment of Liquid Smoke Concentration, Soaking Time, Packaging and Different Storage Time To Yield And Moisture Contentnila Fish Fillet (... International Journal of ChemTech Research 10 (Vol.10 No.1 pp 77-88, 2017 … 1 2017
703 Google Scholar Authors : IK Budaraga Pengabdian kepada masyarakat pembuatan ramuan organic tanaman (ROTAN) di kawasan ekonomi masyarakat (KEM) di Kanagarian Tikalak Kecamatan X Koto Singkarak Kabupaten Solok UNES Journal of Community Service 2 (2), 45-54, 2017 0 2017
704 Google Scholar Authors : IK Budaraga, G Gusriati Ibm Kelompok Tani Tagamang Bajawek di Kabupaten Padang Pariaman Jurnal Penelitian dan Kajian Ilmiah Menara Ilmu 3 (44), 52-57, 2014 0 2014
705 Google Scholar Authors : IK Budaraga, G Gusriati Ibm Kelompok Tani Tagamang Bajawek di Kabupaten Padang Pariaman Jurnal Penelitian dan Kajian Ilmiah Menara Ilmu 3 (44), 52-57, 2014 0 2014
706 Google Scholar Authors : IK Budaraga, G Gusriati Ibm Kelompok Tani Tagamang Bajawek di Kabupaten Padang Pariaman Jurnal Penelitian dan Kajian Ilmiah Menara Ilmu 3 (44), 52-57, 2014 0 2014
707 Google Scholar Authors : RA I Ketut Budaraga Peningkatan Pendapatan Masyarakat Melalui Pemanfaatan Briket Tempurung Kelapa,Kompor Briket dan Asap Cair Di Desa Sungai Rambai Kecamatan Pariaman... Menara ilmu 121 (Vol VIII No.52 Sept 2014 ISSN 1693-2617), 35-49 0 2014
708 Scopus Creator : Budaraga I.K. Characteristics of the liquid chemical properties of cocoa skin [Theobroma cacao L.] in different water levels Iop Conference Series Earth and Environmental Science 2 Q4 as Conference Proceedin 2020
709 IPRs Muhammad Parikesit Wisnubroto, Paskarada Juanti, Rahmah Utami Budiandari, I Ketut Budaraga, Tiara Kumala, Hetty Sri Mulyati, Rita Hayati, Christian Yosua Salomo, Dwiyati Pujimulyani, Gusti Setiavani TEKNOLOGI PENGOLAHAN HASIL PERKEBUNAN EC00202444712 2024
710 IPRs Muhammad Parikesit Wisnubroto, Paskarada Juanti, Rahmah Utami Budiandari, I Ketut Budaraga, Tiara Kumala, Hetty Sri Mulyati, Rita Hayati, Christian Yosua Salomo, Dwiyati Pujimulyani, Gusti Setiavani TEKNOLOGI PENGOLAHAN HASIL PERKEBUNAN EC00202444712 2024
711 IPRs Ika Gusriani, Santi Dwi Astuti, Usman Pato, Herianus Justhianus D. Lalel dkk. Ilmu Bahan Pangan EC00202432262 2024
712 IPRs Ari Kristiningsih Sawarni Hasibuan Hermawan Samsu Adi Rahman Nurhayati Adrianus Orias Willem Kaya Dheasy Herawati Salnida Yuniarti Lumbessy I Ketut Budaraga,Fadly Irmawan Teknologi Pengolahan Rumput Laut EC00202497329 2024
713 Garuda I Ketut Budaraga The Role of Social Media in the Formation of Adolescent Identity: A Review of Psychology and Popular Culture Journal of Dialogos Vol. 2 No. 3 (2025): Journal of Dialogos-AUGUST46-56 Accred : Unknown 2025
714 Garuda I Ketut Budaraga - Maize Nugget Making in Nagari Ladang Panjang, Pasaman Regency, West Sumatra: Pembuatan Nugget Jagung di Nagari Ladang Panjang, Kabupaten Pasaman, Sumatera Barat Journal of Dialogos Vol. 2 No. 3 (2025): Journal of Dialogos-AUGUST46-56 Accred : Unknown 2023
715 Garuda I Ketut Budaraga Pengabdian Kepada Masyarakat Penerapan Teori Kaizen untuk Meningkatan Kualitas Usaha Keripik Talas di UKM Asyifa Oleh-Oleh Journal of Dialogos Vol. 2 No. 3 (2025): Journal of Dialogos-AUGUST46-56 Accred : Unknown 2023
716 Garuda I Ketut Budaraga KAJIAN SIFAT FISIKOKIMIA DAN ORGANOLEPTIK SUSU SAPI MURNI DENGAN PENAMBAHAN ASAP CAIR SELAMA PENYIMPANAN Journal of Dialogos Vol. 2 No. 3 (2025): Journal of Dialogos-AUGUST46-56 Accred : Unknown 2023
717 Garuda I Ketut Budaraga Application of Chitosan Coating and Liquid Smoke as Antimicrobial Agent in Tuna Fish Pempek Journal of Dialogos Vol. 2 No. 3 (2025): Journal of Dialogos-AUGUST46-56 Accred : Unknown 2023
718 Garuda I Ketut Budaraga Pengujian Asam Lemak Bebas Pada Wajik Yang Dilapisi Edible Film Khitosan-PVA Journal of Dialogos Vol. 2 No. 3 (2025): Journal of Dialogos-AUGUST46-56 Accred : Unknown 2022
719 Garuda I Ketut Budaraga PENGABDIAN KEPADA MASYARAKAT PENINGKATAN KUALITAS PRODUKSI TAHU DI USAHA TAHU PAKDE IPONG Journal of Dialogos Vol. 2 No. 3 (2025): Journal of Dialogos-AUGUST46-56 Accred : Unknown 2022
720 Garuda I Ketut Budaraga PENGARUH PENAMBAHAN EKSTRAK GAMBIR (Uncaria gambir Roxb.) SEBAGAI ANTIBAKTERI PADA PEMBUATAN SABUN PADAT OPAQUE Journal of Dialogos Vol. 2 No. 3 (2025): Journal of Dialogos-AUGUST46-56 Accred : Unknown 2022
721 Garuda I Ketut Budaraga KAJIAN MUTU DAN AKTIVITAS ANTIOKSIDAN TEH KULIT KOPI (Coffea Canephora) DENGAN PENAMBAHAN DAUN MINT : Mentha Piperita L Journal of Dialogos Vol. 2 No. 3 (2025): Journal of Dialogos-AUGUST46-56 Accred : Unknown 2021
722 Garuda I Ketut Budaraga PENGARUH PENAMBAHAN SERBUK JAHE MERAH (Zingiber officinale Var. Rubrum) TERHADAP TEH HASIL KEMPAAN DAUN GAMBIR (Uncaria gambir Roxb) Journal of Dialogos Vol. 2 No. 3 (2025): Journal of Dialogos-AUGUST46-56 Accred : Unknown 2021
723 Garuda Putra Bungsu, Iseng Maijen; I Ketut Budaraga; Nita Yessirita PENGARUH PENAMBAHAN SERBUK JAHE MERAH (Zingiber officinale Var. Rubrum) TERHADAP TEH HASIL KEMPAAN DAUN GAMBIR (Uncaria gambir Roxb) Jurnal Research Ilmu Pertanian Vol. 1 No. 2 (2021): Jurnal Research Ilmu Pertanian (Agustus 2021)110-119 Accred : Unknown 2021
724 Garuda Putra Bungsu, Iseng Maijen; I Ketut Budaraga; Nita Yessirita KAJIAN MUTU DAN AKTIVITAS ANTIOKSIDAN TEH KULIT KOPI (CoffeaCanephora) DENGAN PENAMBAHAN DAUN MINT (Mentha Piperita L) Jurnal Research Ilmu Pertanian Vol. 1 No. 2 (2021): Jurnal Research Ilmu Pertanian (Agustus 2021)110-119 Accred : Unknown 2021
725 Garuda Putra Bungsu, Iseng Maijen; I Ketut Budaraga; Nita Yessirita Antibacterial Activity of Moringa Leaf Layer Cake Against S. aureus and E. coli Jurnal Research Ilmu Pertanian Vol. 1 No. 2 (2021): Jurnal Research Ilmu Pertanian (Agustus 2021)110-119 Accred : Unknown 2020
726 Garuda Putra Bungsu, Iseng Maijen; I Ketut Budaraga; Nita Yessirita The Antioxidant Characteristics of The Liquid Smoke of Cocoa Shell ( Theobroma cacao, l ) In Different Water Content Variations Jurnal Research Ilmu Pertanian Vol. 1 No. 2 (2021): Jurnal Research Ilmu Pertanian (Agustus 2021)110-119 Accred : Unknown 2019
727 Garuda Putra Bungsu, Iseng Maijen; I Ketut Budaraga; Nita Yessirita Penyuluhan Jajanan, Makanan dan Kantin Sehat di Sekolah SMA 2 Batang Anai Kecamatan Batang Anai Kabupaten Padang Pariaman Jurnal Research Ilmu Pertanian Vol. 1 No. 2 (2021): Jurnal Research Ilmu Pertanian (Agustus 2021)110-119 Accred : Unknown 2019
728 Garuda Putra Bungsu, Iseng Maijen; I Ketut Budaraga; Nita Yessirita Pelatihan Pemanfaatan Limbah Kelapa (Lidi) Menjadi Kerajinan Tangan di Nagari IV Koto Mudik Kecamatan Batang Kapas Kabupaten Pesisir Selatan Jurnal Research Ilmu Pertanian Vol. 1 No. 2 (2021): Jurnal Research Ilmu Pertanian (Agustus 2021)110-119 Accred : Unknown 2019
729 Garuda Putra Bungsu, Iseng Maijen; I Ketut Budaraga; Nita Yessirita PENGARUH KONSENTRASI STARTER Acetobacter xylinum TERHADAP MUTU NATA DE CUCUMBER Jurnal Research Ilmu Pertanian Vol. 1 No. 2 (2021): Jurnal Research Ilmu Pertanian (Agustus 2021)110-119 Accred : Unknown 2017
730 Garuda Putra Bungsu, Iseng Maijen; I Ketut Budaraga; Nita Yessirita PENGARUH KONSENTRASI STARTER Acetobacter xylinum TERHADAP MUTU NATA DE CUCUMBER Jurnal Research Ilmu Pertanian Vol. 1 No. 2 (2021): Jurnal Research Ilmu Pertanian (Agustus 2021)110-119 Accred : Unknown 2017
731 Google Scholar Authors : IK Budaraga, NPEBP Wulandari Pencegahan Bahaya Mikroplastik Untuk Keamanan Pangan Melalui Edukasi di Panti Asuhan ST. Leo Padang Ekasakti Jurnal Penelitian dan Pengabdian 6 (2), 390-400, 2026 0 2026
732 Google Scholar Authors : FNI Taufik, BM Satria, R Hayati, S Priyadi, BH Perkasa, HS Mulyati, ... INTRODUCTION TO FOOD SCIENCE AND TECHNOLOGY Mawadra Lestari Enterprise, 2025 0 2025
733 Google Scholar Authors : IK Budaraga, L Pujantoro, HK Purwadaria Pengkajian Awal Respirasi Produk Minimally Processed Buah Salak Pondoh Pada Kondisi Penyimpanan Atmosfer Normal Perkemahan Dan Seminar Tahunan PERTETA. PERTETA Cabang Bandung. Jatinangor …, 1997 4 1997
734 Google Scholar Authors : IK Budaraga, L Pujantoro, HK Purwadaria Pengkajian Awal Respirasi Produk Minimally Processed Buah Salak Pondoh Pada Kondisi Penyimpanan Atmosfer Normal Perkemahan Dan Seminar Tahunan PERTETA. PERTETA Cabang Bandung. Jatinangor …, 1997 4 1997
735 Buku Prof.Dr.Ir. I Ketut Budaraga,MSi.CIRR Future Foods Future Food Innovation Based on Local Wisdom and Sustainability Mawadra Lestari Enterprise 2026
736 Buku Prof.Dr.Ir. I Ketut Budaraga,MSi.CIRR PENGAWASAN MUTU AGROINDUSTRI BERBASIS OBE Mawadra Lestari Enterprise 2026
737 Buku Prof.Dr.Ir. I Ketut Budaraga,MSi.CIRR Industri Pengolahan Daging Mawadra Lestari Enterprise 2026
738 Buku Prof.Dr.Ir. I Ketut Budaraga,MSi.CIRR INTRODUCTION TO FOOD SCIENCE AND TECHNOLOGY Mawadra Lestari Enterprise 2026
739 Garuda I Ketut Budaraga; Ni Putu Eka Budi Pradnya Wulandari Pencegahan Bahaya Mikroplastik Untuk Keamanan Pangan Melalui Edukasi di Panti Asuhan ST. Leo Padang Ekasakti Jurnal Penelitian dan Pengabdian Vol. 6 No. 2 (2026): Ekasakti Jurnal Penelitian dan Pengabdian390-400 4 2026
Sumber data: SINTA, per 15 April 2026
© 2025 LPPM Universitas Ekasakti. All rights reserved.