0022066801 - I KETUT BUDARAGA
| No | Kategori Kegiatan | Authors | Judul Kegiatan | Publikasi | Cited | Quality | Tahun Kegiatan |
|---|---|---|---|---|---|---|---|
| 1 | Google Scholar | Authors : AS Fatmawaty, IK Budaraga, GIA Yekti, R Rizkyanto | Konsep Dasar Pengantar Pangan | 0 | 2025 | ||
| 2 | Google Scholar | Authors : IK Budaraga, I Sidabalok, SA Rasyid | Characteristics of pensi pempek (Corbicula moltkiana) on tapioca flour substitution with sago flour | BIO Web of Conferences 159, 01006, 2025 | 0 | 2025 | |
| 3 | Google Scholar | Authors : Z Mustakim, EA Fitria, IK Budaraga | Pendugaan Umur Simpan Sosis Ikan Patin (Pangasius sp) Yang Dilapisi Edible Coating Pati Talas Antimikroba Sari Belimbing Wuluh (Averrhoa bilimbi L) | Jurnal Research Ilmu Pertanian 5 (2), 199-210, 2025 | 0 | 2025 | |
| 4 | Google Scholar | Authors : MP Wisnubroto, P Juanti, RU Budiandari, IK Budaraga, T Kumala, ... | TEKNOLOGI PENGOLAHAN HASIL PERKEBUNAN | CV HEI PUBLISHING INDONESIA, 2024 | 0 | 2024 | |
| 5 | Google Scholar | Authors : AA I Ketut Budaraga | Buku Peranan Teknologi Pengolahan Dan Pengawetan Pangan Berbasis Sumber Daya Dan Kearifan Lokal Untuk Mewujudkan Pangan Sehat | IN Patent EC00,202,420,497, 2024 | 0 | 2024 | |
| 6 | Google Scholar | Authors : IK Budaraga | Uji Beda Pada Uji Sensoris Bahan Pangan | Hei Publishing Indonesia, 2024 | 0 | 2024 | |
| 7 | Google Scholar | Authors : IK Budaraga | Teknologi Pengolahan Kelapa Sawit | Hei Publishing Indonesia, 2024 | 0 | 2024 | |
| 8 | Google Scholar | Authors : IK Budaraga, DP Putra | Study of liquid smoke toxicity cocoa shell with different purification methods | IOP Conference Series: Earth and Environmental Science 1306 (1), 012003, 2024 | 1 | 2024 | |
| 9 | Google Scholar | Authors : RDEKERMSDAPADPNEPEKHKRCPTFYSSNIK Budaraga | Buku Teknologi Pengolahan Dan Hasil Pertanian | IN Patent EC00,202,442,132, 2024 | 0 | 2024 | |
| 10 | Google Scholar | Authors : DE Ropiudin, Ropiudin and Rusman, Rusman and Rachmanita, Risse Entikaria and ... | Teknologi Energi Terbarukan | 0 | 2024 | ||
| 11 | Google Scholar | Authors : RDEKERMSDAPADPNEPEKHKRCPTFYSSNIK Budaraga | Buku Teknologi Pengolahan Dan Hasil Pertanian | IN Patent EC00,202,442,132, 2024 | 0 | 2024 | |
| 12 | Google Scholar | Authors : IK Budaraga | Peranan Rumput Laut Dalam Formulasi Pengembangan Produk Pangan Fungsional | Hei Publishing Indonesia, 2024 | 0 | 2024 | |
| 13 | Google Scholar | Authors : S Nurjanah, K Syska, N Diniyah, IK Budaraga, G Setiavani, E Verawati | Teknologi Tepat Guna Dan Ilmu Terapan | Hei Publishing Indonesia, 2024 | 1 | 2024 | |
| 14 | Google Scholar | Authors : I Sitepu, H Sa'diyah, M Zuhri, N Lailisna, Khairiyah, Fitra, Azmi, S Azizah, ... | Filsafat Ilmu dan Metode Ilmiah | Hei Publishing 1, 89-101, 2024 | 0 | 2024 | |
| 15 | Google Scholar | Authors : HT Pakpahan, S Kurniasih, Y Heryadi, A Fauziah | Konsep pemberdayaan masyarakat | Hei Publishing Indonesia, 2024 | 8 | 2024 | |
| 16 | Google Scholar | Authors : IK Budaraga, L Hermalena, S Aisyah | Alginate Addition from Sargassum Seaweed (Sargassum sp.) on Pumpkin Ice Cream (Cucurbita Moschata Durch.) Characteristics | Annals of Agri-Bio Research 29 (2), 15-26, 2024 | 1 | 2024 | |
| 17 | Google Scholar | Authors : IK Budaraga | Model-Model Pemberdayaan Masyarakat | Hei Publishing Indonesia, 2024 | 0 | 2024 | |
| 18 | Google Scholar | Authors : Rahmawati, DE Kuliahsari, E Rusliana, M Saleh, DA Putri, AD Pamujiati, ... | TEKNOLOGI PENGOLAHAN DAN HASIL PERTANIAN | 0 | 2024 | ||
| 19 | Google Scholar | Authors : IGSDARUPERHJDLUAIKBGEMMNKANAMSK Putri | lmu Bahan Pangan | IN Patent EC00,202,432,262, 2024 | 0 | 2024 | |
| 20 | Google Scholar | Authors : S Sugiarti, DK Sari, D Syukriani, E Zelpina, N Fati, N Nilawati, A Muchlis, ... | Ilmu Teknologi Hasil Ternak | Hei Publishing Indonesia, 2024 | 0 | 2024 | |
| 21 | Google Scholar | Authors : I Sitepu, H Sa'diyah, M Zuhri, N Lailisna, Khairiyah, Fitra, Azmi, S Azizah, ... | Filsafat Ilmu dan Metode Ilmiah | Hei Publishing 1, 89-101, 2024 | 0 | 2024 | |
| 22 | Google Scholar | Authors : HT Pakpahan, S Kurniasih, Y Heryadi, A Fauziah | Konsep pemberdayaan masyarakat | Hei Publishing Indonesia, 2024 | 8 | 2024 | |
| 23 | Google Scholar | Authors : S Sugiarti, DK Sari, D Syukriani, E Zelpina, N Fati, N Nilawati, A Muchlis, ... | Ilmu Teknologi Hasil Ternak | Hei Publishing Indonesia, 2024 | 0 | 2024 | |
| 24 | Google Scholar | Authors : IK Budaraga, L Hermalena, S Aisyah | Alginate Addition from Sargassum Seaweed (Sargassum sp.) on Pumpkin Ice Cream (Cucurbita Moschata Durch.) Characteristics | Annals of Agri-Bio Research 29 (2), 15-26, 2024 | 1 | 2024 | |
| 25 | Google Scholar | Authors : IK Budaraga | Model-Model Pemberdayaan Masyarakat | Hei Publishing Indonesia, 2024 | 0 | 2024 | |
| 26 | Google Scholar | Authors : Rahmawati, DE Kuliahsari, E Rusliana, M Saleh, DA Putri, AD Pamujiati, ... | TEKNOLOGI PENGOLAHAN DAN HASIL PERTANIAN | 0 | 2024 | ||
| 27 | Google Scholar | Authors : IGSDARUPERHJDLUAIKBGEMMNKANAMSK Putri | lmu Bahan Pangan | IN Patent EC00,202,432,262, 2024 | 0 | 2024 | |
| 28 | Google Scholar | Authors : IK Budaraga | Pengolahan Biogas | Hei Publishing Indonesia, 2024 | 0 | 2024 | |
| 29 | Google Scholar | Authors : IK Budaraga | Ilmu Sagu | Hei Publishing Indonesia, 2024 | 0 | 2024 | |
| 30 | Google Scholar | Authors : IK Budaraga, EA Fitria, S Susilawati | The Identification of Salmonella SP on Food Preparations (Seasoning and Rakik Chips) in Padang City | Proceeding International Conference Khairun University 1 (1), 266-271, 2024 | 0 | 2024 | |
| 31 | Google Scholar | Authors : AC MUSTIKANINGRUM | ILMU BAHAN PANGAN | Media Sains Indonesia, 2024 | 0 | 2024 | |
| 32 | Google Scholar | Authors : ISHS diyah Mahbub Zuhri Novi Nur Lailisna Khairiah Fitra Azmi Siti Azizah ... | Buku Filsafat Ilmu Dan Metode Ilmiah | IN Patent EC00,202,439,778, 2024 | 0 | 2024 | |
| 33 | Google Scholar | Authors : IK Budaraga | Faktor Proses Pengolahan Dengan Pemanasan | Hei Publishing Indonesia, 2024 | 0 | 2024 | |
| 34 | Google Scholar | Authors : MIFGAPRERMSIRIKBSSSRNSDANNZN Fayyadh | Buku Teknik Evaluasi Sensori Produk Pangan | IN Patent EC00,202,445,806, 2024 | 0 | 2024 | |
| 35 | Google Scholar | Authors : DP Budaraga, I.K. , Putra | Study of liquid smoke toxicity cocoa shell with different purification methods8 | IOP Conference Series: Earth and Environmental Science 1 (IOP), 8, 2024 | 0 | 2024 | |
| 36 | Google Scholar | Authors : IK Budaraga | Laporan Ilmiah | Hei Publishing Indonesia, 2024 | 0 | 2024 | |
| 37 | Google Scholar | Authors : IK Budaraga | Teknologi Ekstruksi Pada Pangan | Hei Publishing Indonesia, 2024 | 0 | 2024 | |
| 38 | Google Scholar | Authors : IK Budaraga, M Sentia | Study of determination of benzoic acid, ascorbic acid in food using high performance liquid chromatography (HPLC) method | AIP Conference Proceedings 2765 (1), 020006, 2023 | 0 | 2023 | |
| 39 | Google Scholar | Authors : AH Samudra, RA Salihat, IK Budaraga | Characteristics of Brown Rice (Oryza nivara) Stored Using Various Packaging with The Addition of Pandanus Powder (Pandanus amaryllifolius Roxb.) | Springer Nature, 2023 | 0 | 2023 | |
| 40 | Google Scholar | Authors : IK Budaraga | Pengaruh Pemanenan dan Penanganan Terhadap Gizi Pangan | Hei Publishing Indonesia, 2023 | 0 | 2023 | |
| 41 | Google Scholar | Authors : IK Budaraga, DP Putra | Antioxidant study of the gambier leaves by-products into tea with red ginger powder addition (Zingiber officinale var. Rubrum) | AIP Conference Proceedings 2583 (1), 090023, 2023 | 0 | 2023 | |
| 42 | Google Scholar | Authors : EA Fitria, IK Budaraga, RA Salihat | The effect of wuluh starfruit (Averrhoa bilimbi L.) added on the physicochemical and antimicrobial characteristics of chitosan-PVA edible film | Future of Food: Journal on Food, Agriculture and Society 11 (5), 2023 | 2 | 2023 | |
| 43 | Google Scholar | Authors : IK Budaraga, RA Salihat, EA Fitria | The study of the utilization of wuluh starfruit (Averrhoa bilimbi L.) in cottage cheese from goat milk prepared with acidification method based on physicochemical … | 1 | 2023 | ||
| 44 | Google Scholar | Authors : IK Budaraga | Alat Pembuat Asap cair dengan Sistem Vakum | 0 | 2023 | ||
| 45 | Google Scholar | Authors : IK Budaraga, M Sentia | Study of determination of benzoic acid, ascorbic acid in food using high performance liquid chromatography (HPLC) method | AIP Conference Proceedings 2765 (1), 020006, 2023 | 0 | 2023 | |
| 46 | Google Scholar | Authors : IK Budaraga | Pengaruh Pemanenan dan Penanganan Terhadap Gizi Pangan | Hei Publishing Indonesia, 2023 | 0 | 2023 | |
| 47 | Google Scholar | Authors : IK Budaraga, RA Salihat, EA Fitria | Acidification effects of starfruit (Averrhoa bilimbi L.) on soy milk-based cottage cheese: a physicochemical and organoleptic assessment | Potravinarstvo Slovak Journal of Food Sciences 17, 986-996, 2023 | 2 | 2023 | |
| 48 | Google Scholar | Authors : IK Budaraga, L Hermalena, S Susanti | Application of Chitosan Coating and Liquid Smoke as Antimicrobial Agent in Tuna Fish Pempek | Jurnal Gizi dan Pangan 18 (Supp. 1), 81-83, 2023 | 1 | 2023 | |
| 49 | Google Scholar | Authors : IK Budaraga, RA Salihat, EA Fitria | Acidification effects of starfruit (Averrhoa Bilimbi L.) on soy milk-based cottage cheese: A physicochemical and organoleptic assessment. | Potravinarstvo Slovak Journal of Food Sciences 17, 986-996, 2023 | 2 | 2023 | |
| 50 | Google Scholar | Authors : EAF I Ketut Budaraga, Rera Aga Salihat | KEJU COTTAGE DARI SUSU SAPI DENGAN PENAMBAHAN BELIMBING WULUH | 0 | 2023 | ||
| 51 | Google Scholar | Authors : IK Budaraga, RA Salihat, EA Fitria | The study of the utilization of wuluh starfruit (Averrhoa bilimbi L.) in cottage cheese from goat milk prepared with acidification method based on physicochemical … | 1 | 2023 | ||
| 52 | Google Scholar | Authors : IK Budaraga, M Sentia | Study of determination of benzoic acid, ascorbic acid in food using high performance liquid chromatography (HPLC) method | AIP Conference Proceedings 2765 (1), 020006, 2023 | 0 | 2023 | |
| 53 | Google Scholar | Authors : IK Budaraga | Pengaruh Pemanenan dan Penanganan Terhadap Gizi Pangan | Hei Publishing Indonesia, 2023 | 0 | 2023 | |
| 54 | Google Scholar | Authors : EAF I Ketut Budaraga, Rera Aga Salihat | KEJU COTTAGE DARI SUSU SAPI DENGAN PENAMBAHAN BELIMBING WULUH | 0 | 2023 | ||
| 55 | Google Scholar | Authors : IK Budaraga, RA Salihat, EA Fitria | Acidification effects of starfruit (Averrhoa bilimbi L.) on soy milk-based cottage cheese: a physicochemical and organoleptic assessment | Potravinarstvo Slovak Journal of Food Sciences 17, 986-996, 2023 | 2 | 2023 | |
| 56 | Google Scholar | Authors : IK Budaraga, EA Fitria | -Maize Nugget Making in Nagari Ladang Panjang, Pasaman Regency, West Sumatra | Dinamisia: Jurnal Pengabdian Kepada Masyarakat 7 (4), 1184-1189, 2023 | 1 | 2023 | |
| 57 | Google Scholar | Authors : IK Budaraga | Proses Pembuatan Asap Cair Dengan Sistem Vakum | 0 | 2022 | ||
| 58 | Google Scholar | Authors : EA Fitria, IK Budaraga, S Zebua | Pengujian Asam Lemak Bebas Pada Wajik Yang Dilapisi Edible Film Khitosan-PVA | SAGU Journal–Agri. Sci. Tech 22 (1), 38-42, 2022 | 1 | 2022 | |
| 59 | Google Scholar | Authors : IK Budaraga, DP Putra, Y Yanti | Microbial activities and minimum liquid smoke killing concentration made of cacao pod toward Lasiodiplodia theobromae growth | IOP Conference Series: Earth and Environmental Science 1059 (1), 012068, 2022 | 3 | 2022 | |
| 60 | Google Scholar | Authors : IK Budaraga, DP Putra | Study of Antioxidant Liquid Smoke Cacao Fruit Peel Waste at Different Water Content and Pyrolysis Temperatures | 0 | 2022 | ||
| 61 | Google Scholar | Authors : IK Budaraga, M Risti, W Sumarno | Pengabdian Kepada Masyarakat Peningkatan Kualitas Produksi Tahu Di Usaha Tahu Pakde Ipong (Service To The Community Improving The Quality Of Touch Production In Business Tahu … | Logista Jurnal Ilmiah Pengabdian kepada Masyarakat 6 (1), 91-97, 2022 | 0 | 2022 | |
| 62 | Google Scholar | Authors : IKB Ni Luh Kartini | Pertanian Terpadu Organik Sistem SabicaITaLA mendukung Ekonomi Berkelanjutan | 0 | 2022 | ||
| 63 | Google Scholar | Authors : I Ketut Budaraga, RA Salihat | Heavy metals analysis (Cd, Pb, Zn, Cu, Cr) and calcium in Padang and Padang Panjang fresh cow's milk | IOP Conference Series: Earth and Environmental Science 1038 (1), 012076, 2022 | 2 | 2022 | |
| 64 | Google Scholar | Authors : IK Budaraga, N Yulita, R Ramaiyulis | Study of Escherichia Coli and Salmonella Sp. Bacterial Contamination from Meatball Seller on Bandar Buat Market in Padang City | INTERNATIONAL CONFERENCE ON GLOBAL EDUCATION, 425-433, 2022 | 0 | 2022 | |
| 65 | Google Scholar | Authors : IK Budaraga | Proses Pembuatan Asap Cair Dengan Sistem Vakum | 0 | 2022 | ||
| 66 | Google Scholar | Authors : EA Fitria, IK Budaraga, S Zebua | Pengujian Asam Lemak Bebas Pada Wajik Yang Dilapisi Edible Film Khitosan-PVA | SAGU Journal–Agri. Sci. Tech 22 (1), 38-42, 2022 | 1 | 2022 | |
| 67 | Google Scholar | Authors : E Aidila Fitria, I Ketut Budaraga, S Zebua | Pengujian Asam Lemak Bebas Pada Wajik Yang Dilapisi Edible Film Khitosan-Pva Testing of Free Fatty Acids on a Wajik Coated Edible Film Khitosan-Pva | SAGU Journal: Agricultural Science and Technology 21 (1), 38-42, 2022 | 3 | 2022 | |
| 68 | Google Scholar | Authors : IK Budaraga, M Risti, W Sumarno | PENGABDIAN KEPADA MASYARAKAT PENINGKATAN KUALITAS PRODUKSI TAHU DI USAHA TAHU PAKDE IPONG | LOGISTA-Jurnal Ilmiah Pengabdian kepada Masyarakat 6 (1), 2022 | 0 | 2022 | |
| 69 | Google Scholar | Authors : IK Budaraga, DP Putra, Y Yanti | Microbial activities and minimum liquid smoke killing concentration made of cacao pod toward Lasiodiplodia theobromae growth | IOP Conference Series: Earth and Environmental Science 1059 (1), 012068, 2022 | 3 | 2022 | |
| 70 | Google Scholar | Authors : IK Budaraga, DP Putra | Study of Antioxidant Liquid Smoke Cacao Fruit Peel Waste at Different Water Content and Pyrolysis Temperatures | 0 | 2022 | ||
| 71 | Google Scholar | Authors : IK Budaraga, RA Salihat | Heavy metals analysis (Cd, Pb, Zn, Cu, Cr) and calcium in Padang and Padang Panjang fresh cow’s milk | IOP Conference Series: Earth and Environmental Science 1038 (1), 012076, 2022 | 3 | 2022 | |
| 72 | Google Scholar | Authors : IK Budaraga, S Susilawati | Sosialisasi Kepada Masyarakat Peningkatan Kualitas Olahan Ikan Maco Di Ukm “Rodi Maco” | Seminar nasional pengabdian kepada masyarakat (SNPKM), 1-5, 2021 | 0 | 2021 | |
| 73 | Google Scholar | Authors : D Syukriani, Ramaiyulis, Nilawati, E Yulia, IK Budaraga | Potential and development of incubation technology to improve the quality of" dadih" as a specific food of minangkabau. | 0 | 2021 | ||
| 74 | Google Scholar | Authors : IK Budaraga, RA Salihat | The effect of material amount in distillation tank to chemical composition of citronella oil (Cymbopogon nardus L. Rendle) | IOP Conference Series: Earth and Environmental Science 653 (1), 012043, 2021 | 4 | 2021 | |
| 75 | Google Scholar | Authors : NY I Ketut Budaraga | Study of Escherichia coliand Salmonella sp. bacterial contamination from meatball seller on Bandar Buat market in Padang City | Journal of Tropical Industrial Agriculture and Rural Development 1 (2), 52-56, 2021 | 0 | 2021 | |
| 76 | Google Scholar | Authors : IK Budaraga, DP Putra | Analysis antioxidant IC50 liquid smoke of cocoa skin with several purification methods | IOP Conference Series: Earth and Environmental Science 757 (1), 012053, 2021 | 8 | 2021 | |
| 77 | Google Scholar | Authors : IK Budaraga, W Sri Devi | Pengabdian kepada masyarakat peningkatan kualitas usaha keripik talas Asyifa oleh-oleh | 12 | 2021 | ||
| 78 | Google Scholar | Authors : IK Budaraga, R Ramaiyulis, D Syukriani, N Nilawati, E Yulia | Potential and development of incubation technology to improve the quality of" dadih" as a specific food of minangkabau | Livestock Research for Rural Development 33 (7) 2021 33 (7), 2021 | 1 | 2021 | |
| 79 | Google Scholar | Authors : IK Budaraga, RA Salihat | Analysis of metals (Pb, Mn, Cd, Zn, Cu) in purple rice and purple rice stems cultivated organically using biogas slug in Padang Pariaman, West Sumatra Province | IOP Conference Series: Earth and Environmental Science 709 (1), 012071, 2021 | 7 | 2021 | |
| 80 | Google Scholar | Authors : IK Budaraga, D Pramana Putra, Y Yanti | Antimicrobial Activity and Liquid Smoke Minimum Kill Concentration of Cocoa Shell on the Growth of the Lasiodiplodia Theobromae Fungi | 0 | 2021 | ||
| 81 | Google Scholar | Authors : IK Budaraga, F Maidija | Pengabdian kepada Masyarakat Peningkatan Kualitas Kopi Solok Radjo | Prosiding Seminar Nasional Pengabdian Kepada Masyarakat 1 (1), 181-190, 2021 | 4 | 2021 | |
| 82 | Google Scholar | Authors : IK Budaraga, WS Devi | ‘Penguatan Ketahanan Masyarakat dalam Menghadapi Era New Normal melalui Penerapan Teknologi Tepat Guna Bidang Pertanian’Potensi Budidaya Tanaman Hias di Kelompok Wanita Tani … | Semin. Nas. Pengabdi 1 (1), 59-65, 2021 | 1 | 2021 | |
| 83 | Google Scholar | Authors : S Wilanda, N Yessirita, IK Budaraga | KAJIAN MUTU DAN AKTIVITAS ANTIOKSIDAN TEH KULIT KOPI (Coffea Canephora) DENGAN PENAMBAHAN DAUN MINT | Jurnal Research Ilmu Pertanian 1 (1), 86-93, 2021 | 7 | 2021 | |
| 84 | Google Scholar | Authors : S Wilanda, N Yessirita, IK Budaraga | Kajian Mutu Dan Aktivitas Antioksidan Teh Kulit Kopi (Coffeacanephora) Dengan Penambahan Daun Mint (Mentha Piperita L) | Jurnal Research Ilmu Pertanian 1 (1), 76-83, 2021 | 12 | 2021 | |
| 85 | Google Scholar | Authors : IK Budaraga, N Yulita, N Yessirita | Antibacterial study of cocoa skin liquid smoke in raw milk | IOP Conference Series: Earth and Environmental Science 803 (1), 012034, 2021 | 5 | 2021 | |
| 86 | Google Scholar | Authors : IM Putra Bungsu, IK Budaraga, N Yessirita | Pengaruh penambahan serbuk jahe merah (Zingiber officinale Var. rubrum) terhadap teh hasil kempaan daun gambir (Uncaria gambir Roxb) | Jurnal Research Ilmu Pertanian (JRIP) 2 (1), 120-129, 2021 | 5 | 2021 | |
| 87 | Google Scholar | Authors : IK Budaraga, DP Putra | Test liquid smoke toxicity for cocoa skin [Theobroma Cacao L.] with the BSLT method at different pyrolysis temperatures | IOP Conference Series: Earth and Environmental Science 741 (1), 012011, 2021 | 3 | 2021 | |
| 88 | Google Scholar | Authors : IK Budaraga, V Saibuma, L Hermalena | Quality of red tuna (Yellowfin tuna) fishball, white oyster mushroom (Pleurotus ostreatus) on different types of packaging and storage time | IOP Conference Series: Earth and Environmental Science 715 (1), 012068, 2021 | 8 | 2021 | |
| 89 | Google Scholar | Authors : IK Budaraga, DP Putra | Characteristics of the liquid chemical properties of cocoa skin [Theobroma cacao L.] in different water levels | IOP Conference Series: Earth and Environmental Science 497 (1), 012016, 2020 | 2 | 2020 | |
| 90 | Google Scholar | Authors : IK Budaraga, D Pramana Putra, W Wellyalina | Antibacterial activity of moringa leaf layer cake against S. aureus and E. coli | Journal of Applied Agricultural Science and Technology 4 (1), 694-708, 2020 | 8 | 2020 | |
| 91 | Google Scholar | Authors : IK Budaraga, DP Putra | Study of Antioxidant Liquid Smoke Cacao Fruit Peel Waste at Different Water Content and Pyrolysis Temperatures | 0 | 2020 | ||
| 92 | Google Scholar | Authors : NL Kartini, IK Budaraga | Pertanian Organik Penyelamat Kehidupan | Deepublish, 2020 | 7 | 2020 | |
| 93 | Google Scholar | Authors : C Wulandari, IK Budaraga, W Wellyalina, N Liamnimitr | Proximate test and organoleptic test on the characteristics of the moringa layer CAKE | Andalasian International Journal of Agriculture and Natural Sciences (AIJANS …, 2020 | 5 | 2020 | |
| 94 | Google Scholar | Authors : C Wulandari, IK Budaraga, W Williyana, L Napassawan | Proximate Test and Organoleptik Test on The Characteristics of the moringa Layer Cake | Andalasian International Journal of Agricultural and Natural Sciences 1 (01 …, 2020 | 4 | 2020 | |
| 95 | Google Scholar | Authors : IK Budaraga, DP Putra | Study of Green Tea Catechin Dipped with Moringa Leaves | IOP Conference Series: Earth and Environmental Science 515 (1), 012027, 2020 | 2 | 2020 | |
| 96 | Google Scholar | Authors : IK Budaraga, RA Salihat | Antioxidant activity of ‘broken skin’purple rice,‘skinned’purple rice, and purple rice stem organically cultivated in Indonesia | International Journal on Advanced Science, Engineering and Information …, 2020 | 7 | 2020 | |
| 97 | Google Scholar | Authors : IK Budaraga, DP Putra | Study of the physical properties of liquid smoke from cocoa rind on moisture content and different pyrolysis temperature | IOP Conference Series: Earth and Environmental Science 542 (1), 012045, 2020 | 2 | 2020 | |
| 98 | Google Scholar | Authors : IK Budaraga, R Ramaiyulis | Study of Escherichia Coli and Salmonella Sp. Bacterial Contamination from Meatball Seller on Bandar Buat Market in Padang City | International Conference on Global Education IX 1 (1), 425-433, 2020 | 0 | 2020 | |
| 99 | Google Scholar | Authors : IK Budaraga, S Syafrudin, G Gusriati, W Sumarno | Pelatihan Pemanfaatan Limbah Kelapa (Lidi) Menjadi Kerajinan Tangan di Nagari IV Koto Mudik Kecamatan Batang Kapas Kabupaten Pesisir Selatan | Buletin Udayana Mengabdi 18 (3), 2019 | 0 | 2019 | |
| 100 | Google Scholar | Authors : IK Budaraga | Penyuluhan Manfaat Penerapan Pertanian Organik Di Kelompok Tani Kampung Apar Nagari Se Buluh Kecamatan Batang Anai Kabupaten Padang Pariaman | 1 | 2019 | ||
| 101 | Google Scholar | Authors : IK Budaraga | Buku manual Cara Pembuatan Asap Cair dari Buah Kakao dan Aplikasi Sebagai Pestisida Tanaman Kakao | 0 | 2019 | ||
| 102 | Google Scholar | Authors : IK Budaraga | Buku Manual Cara Pembuatan Asap Cair Dari Buah Kulit Kakao Dan Aplikasi Sebagai Pestisida Alami Pada Tanaman Kakao | 0 | 2019 | ||
| 103 | Google Scholar | Authors : IK Budaraga, E Susanti | Study of Toxicity of Cacao Skin Liquid (Theobroma cacao, L) Using BSLT Method (Brine Shrimp Lethality Test) | International Journal of ChemTech Research 12 (5), 8-17, 2019 | 0 | 2019 | |
| 104 | Google Scholar | Authors : IK Budaraga, DP Putra | Liquid smoke antimicrobial test of cocoa fruit peel against eschericia coli and staphylococcus aureus bacteria | IOP Conference Series: Earth and Environmental Science 365 (1), 012049, 2019 | 16 | 2019 | |
| 105 | Google Scholar | Authors : IK Budaraga, R Ramaiyulis, E Nurdin, R Rauf | Penyuluhan Jajanan, Makanan dan Kantin Sehat di Sekolah SMA 2 Batang Anai Kecamatan Batang Anai Kabupaten Padang Pariaman | Buletin Udayana Mengabdi 18 (3), 61-67, 2019 | 11 | 2019 | |
| 106 | Google Scholar | Authors : IK Budaraga | Study of Antioxidant Liquid Smoke Cacao Fruit Peel Waste at Different Water Content and Pyrolysis Temperatures | 0 | 2019 | ||
| 107 | Google Scholar | Authors : IK Budaraga, RA Salihat | Study of chemical components of liquid smoke from cocoa rind in two variations of moisture content by using GC-MS method | IOP Conference Series: Earth and Environmental Science 383 (1), 012023, 2019 | 0 | 2019 | |
| 108 | Google Scholar | Authors : IK Budaraga, S Syafrudin, G Gusriati, W Sumarno | Pelatihan Pemanfaatan Limbah Kelapa (Lidi) Menjadi Kerajinan Tangan di Nagari IV Koto Mudik Kecamatan Batang Kapas Kabupaten Pesisir Selatan | Buletin Udayana Mengabdi 18 (3), 2019 | 0 | 2019 | |
| 109 | Google Scholar | Authors : IK Budaraga | Penyuluhan Manfaat Penerapan Pertanian Organik Di Kelompok Tani Kampung Apar Nagari Se Buluh Kecamatan Batang Anai Kabupaten Padang Pariaman | 1 | 2019 | ||
| 110 | Google Scholar | Authors : IKB Ni Luh Kartini | Pertanian Organik Penyelamat Kehidupan | 0 | 2019 | ||
| 111 | Google Scholar | Authors : IK Budaraga, S Syafrudin, G Gusriati, W Sumarno | Pelatihan Pemanfaatan Limbah Kelapa (Lidi) Menjadi Kerajinan Tangan di Nagari IV Koto Mudik Kecamatan Batang Kapas Kabupaten Pesisir Selatan | Buletin Udayana Mengabdi 18 (3), 2019 | 0 | 2019 | |
| 112 | Google Scholar | Authors : IK Budaraga | Penyuluhan Manfaat Penerapan Pertanian Organik Di Kelompok Tani Kampung Apar Nagari Se Buluh Kecamatan Batang Anai Kabupaten Padang Pariaman | 1 | 2019 | ||
| 113 | Google Scholar | Authors : IK Budaraga | Effect of Combination Treatment of Concentration Liquid Smoke, Immersion Duration. Packaging and Old Type Storage different Levels of Fat Fish Tilapia Fillet (Or... | International Journal of ChemTech Research 11 (02), 244-254 | 1 | 2018 | |
| 114 | Google Scholar | Authors : IK Budaraga | Effect of Combination Treatment Of Concentration Liquid Smoke, Immersion Duration, Packaging And Old Type Storage Different Levels Of Phenol And Carbonil Nila Fish Fillet … | International Journal of ChemTech Research 11 (08), 364-380, 2018 | 3 | 2018 | |
| 115 | Google Scholar | Authors : LH I ketut Budaraga, Yossi Oktavia | Study of the Quality chemical of Fresh Drinks Corens with the Use of Different Types of Oranges | International Journal of ChemTech Research 11 (11), 1-8, 2018 | 0 | 2018 | |
| 116 | Google Scholar | Authors : IK Budaraga | Buku Liquid Smoke Toxicity With Variation Of Temperature And Concentration | 0 | 2018 | ||
| 117 | Google Scholar | Authors : IK Budaraga, S Wahyuni, A Asnurita | Characteristics of Physical and Chemical of Cocoa Skin Liquid Smoke (Treoboma Cacao L.) on different Moisture Content | 0 | 2018 | ||
| 118 | Google Scholar | Authors : IK Budaraga | The Effect of Combination of Liquid SmokeTo Degrees of Material (PH) Fillet Fish Tilapia | International Journal of ChemTech Research 11 (2), 207-218, 2018 | 1 | 2018 | |
| 119 | Google Scholar | Authors : IK Budaraga | Effect of Combination Treatment of Concentration Liquid Smoke, Immersion Duration. Packaging and Old Type Storage different Levels of Fat Fish Tilapia Fillet (Oreochromis … | International Journal of ChemTech Research 11 (02), 244-254, 2018 | 3 | 2018 | |
| 120 | Google Scholar | Authors : IK Budaraga | Effect Of Combination Treatment Of Concentration Liquid Smoke, Immersion Duration, Packaging And Old Type Storage Different Levels Of Fiber And Ash Fish Tilapia Fillet … | International Journal of ChemTech Research 11 (No.08), 347-365 | 2 | 2018 | |
| 121 | Google Scholar | Authors : IK Budaraga | Kajian Mutu Minuman Segar Corens Dengan Penggunaan Berbagai Jenis Jeruk | 0 | 2018 | ||
| 122 | Google Scholar | Authors : IK Budaraga | Effect of Combination Treatment of Concentration Liquid Smoke, Immersion Duration. Packaging and Old Type Storage different Levels of Fat Fish Tilapia Fillet (Oreochromis … | International Journal of ChemTech Research 11 (02), 244-254 | 2 | 2018 | |
| 123 | Google Scholar | Authors : IK Budaraga | Laporan penelitian: Kajian Mutu Fillet Lele Asap Yang Diberikan Asap Cair Kayu Manis | 0 | 2018 | ||
| 124 | Google Scholar | Authors : IK Budaraga | Effect of Combination Treatment of Concentration Liquid Smoke, Immersion Duration. Packaging and Old Type Storage different Levels of Fat Fish Tilapia Fillet (Or... | International Journal of ChemTech Research 11 (02), 244-254 | 1 | 2018 | |
| 125 | Google Scholar | Authors : IK Budaraga | Effect of Combination Treatment Of Concentration Liquid Smoke, Immersion Duration, Packaging And Old Type Storage Different Levels Of Phenol And Carbonil Nila Fish Fillet … | International Journal of ChemTech Research 11 (08), 364-380, 2018 | 3 | 2018 | |
| 126 | Google Scholar | Authors : LH I ketut Budaraga, Yossi Oktavia | Study of the Quality chemical of Fresh Drinks Corens with the Use of Different Types of Oranges | International Journal of ChemTech Research 11 (11), 1-8, 2018 | 0 | 2018 | |
| 127 | Google Scholar | Authors : IK Budaraga | Buku Liquid Smoke Toxicity With Variation Of Temperature And Concentration | 0 | 2018 | ||
| 128 | Google Scholar | Authors : IK Budaraga, S Wahyuni, A Asnurita | Characteristics of Physical and Chemical of Cocoa Skin Liquid Smoke (Treoboma Cacao L.) on different Moisture Content | 0 | 2018 | ||
| 129 | Google Scholar | Authors : IK Budaraga | Effect of Combination Treatment of Concentration Liquid Smoke, Immertion Duration, Packaging and old Type Storagedifferent Levels of Protein Nila Fish Fillet (Ore... | International Journal of ChemTech Research, 01-10 | 1 | 2017 | |
| 130 | Google Scholar | Authors : IK Budaraga | Processing taro tubers (Colocasia esculenta (L) Schott) become flour as efforts to increase community revenues in mentawai region | Journal of Life Sciences Research 5 (2), 62-70, 2017 | 3 | 2017 | |
| 131 | Google Scholar | Authors : IK Budaraga | Effect of Combination Treatment of Liquid Smoke Concentration, Soaking Time, Packaging and Different Storage Time To Yield And Moisture Contentnila Fish Fillet (Oreochromis niloticus) | International Journal of ChemTech Research 10 (Vol.10 No.1 pp 77-88, 2017 ... | 0 | 2017 | |
| 132 | Google Scholar | Authors : IK Budaraga | Effect of Combination Treatment of Concentration Liquid Smoke, Immertion Duration, Packaging and old Type Storagedifferent Levels of Protein Nila Fish Fillet | 3 | 2017 | ||
| 133 | Google Scholar | Authors : IK Budaraga | Effect of Combination Treatment of Concentration Liquid Smoke, Immersion Duration, Packaging and Long Storage different Levels of Antibacterials Nila Fish Fillet (Oreochromis … | International Journal of ChemTech Research 10 (15), 317-331, 2017 | 0 | 2017 | |
| 134 | Google Scholar | Authors : IK Budaraga | Effect of Combination Treatment of Concentration Liquid Smoke, Immersion Duration, Packaging and Long Storage different Levels of Antioxidant Tilapia Fish Fillet (Oreochromis … | International Journal of ChemTech Research 10 (nomor 15), 332-343 | 2 | 2017 | |
| 135 | Google Scholar | Authors : IKB Gusriati 1), Armia2) | ESTABLISHING ORGANIC RICE PRODUCTION: TECHNICAL, ECONOMIC AND SOCIAL CONSTRAINTS (Case Study on Organic Farmers in Nagari Sariek Alahan... | UNES Journal Agricultural Scienties 1 (2), 167-175 | 0 | 2017 | |
| 136 | Google Scholar | Authors : IK Budaraga, W Winda, D Prima Putra | Study about Some Quality of Green Tea Ground with Addition of Red Ginger Powder (Zingiber Officinale Rosc) | International Journal of Life Sciences Research 5 (3), 8-17, 2017 | 0 | 2017 | |
| 137 | Google Scholar | Authors : IK Budaraga | Rice Intelligent From Making Mocaf (Modified Cassava Flour) | Universitas Ekasakti Padang (International Conference on Global Education V …, 2017 | 0 | 2017 | |
| 138 | Google Scholar | Authors : G Gusriati, A Armia, IK Budaraga | ESTABLISHING ORGANIC RICE PRODUCTION: TECHNICAL, ECONOMIC AND SOCIAL CONSTRAINTS (Case Study on Organic Farmers in Nagari Sariek Alahan Tigo, Hiliran Gumanti Sub-District … | UNES Journal of Agricultural Scienties 1 (2), 167-175 | 0 | 2017 | |
| 139 | Google Scholar | Authors : IK Budaraga | PENGABDIAN KEPADA MASYARAKAT PEMBUATAN RAMUAN ORGANIK TANAMAN (ROTAN) DIKAWASAN EKONOMI MASYARAKAT (KEM) KANAGARIAN TIKALAK KECAMATAN X KOTO SINGKARAK KABUPATEN SOLOK | UNES Journal of Community Service 2 (2), 127-134, 2017 | 0 | 2017 | |
| 140 | Google Scholar | Authors : YMS Asnurita, IK Budaraga | Pengaruh konsentrasi starter Acetobacter xylinum terhadap mutu nata de cucumber | Jurnal pertanian UMSB 1 (2), 2017 | 6 | 2017 | |
| 141 | Google Scholar | Authors : IK Budaraga | Processing taro tubers (Colocasia esculenta (L) Schott) become flour as efforts to increase community revenues in mentawai region | Journal of Life Sciences Research 5 (2), 62-70, 2017 | 3 | 2017 | |
| 142 | Google Scholar | Authors : IK Budaraga, UB Arnim, Yetti Marlida | Liquid Smoke Toxicity Properties of Production of Raw Materials With Variation of Temperature and Concentration of Different | International Journal of PharmTech Research 9 (10), 10, 2017 | 9 | 2017 | |
| 143 | Google Scholar | Authors : IK Budaraga | Effect of Combination Treatment of Concentration Liquid Smoke, Immersion Duration, Packaging and Long Storage different Levels of Antibacterials Nila Fish Fillet (... | International Journal of ChemTech Research 10 (no.15), 317-331 | 1 | 2017 | |
| 144 | Google Scholar | Authors : IK Budaraga, R Ramaiyulis, E Nurdin | Vegetable Cultivation Hydroponics System In Community Economic Zone (KEM) Kanagarian Tikalak Subdistrict X Koto Singkarak Districts Solok | Journal of Scientific and Technology Research 6 (5), 29-34, 2017 | 1 | 2017 | |
| 145 | Google Scholar | Authors : S Maria, IK Budaraga, L Hermalena | Pendugaan Umur Simpan Minuman Corens Dengan Metode Arrhenius | UNES Journal Mahasiswa Pertanian 1 (1), 034-042, 2017 | 0 | 2017 | |
| 146 | Google Scholar | Authors : G Gusriati, A Armia, IK Budaraga | ESTABLISHING ORGANIC RICE PRODUCTION: TECHNICAL, ECONOMIC AND SOCIAL CONSTRAINTS (Case Study on Organic Farmers in Nagari Sariek Alahan Tigo, Hiliran Gumanti Sub-District … | UNES Journal of Agricultural Scienties 1 (2), 167-175, 2017 | 0 | 2017 | |
| 147 | Google Scholar | Authors : IK Budaraga | Effect of Combination Treatment of Liquid Smoke Concentration, Soaking Time, Packaging and Different Storage Time To Yield And Moisture Contentnila Fish Fillet (Oreochromis … | International Journal of ChemTech Research 10 (Vol.10 No.1 pp 77-88, 2017 … | 0 | 2017 | |
| 148 | Google Scholar | Authors : IK Budaraga | Effect of Combination Treatment of Liquid Smoke Concentration, Soaking Time, Packaging and Different Storage Time To Yield And Moisture Contentnila Fish Fillet (Oreochromis niloticus) | International Journal of ChemTech Research 10 (Vol.10 No.1 pp 77-88, 2017 ... | 0 | 2017 | |
| 149 | Google Scholar | Authors : IK Budaraga | Effect of Combination Treatment of Concentration Liquid Smoke, Immertion Duration, Packaging and old Type Storagedifferent Levels of Protein Nila Fish Fillet | 3 | 2017 | ||
| 150 | Google Scholar | Authors : IK Budaraga | Effect of Combination Treatment of Concentration Liquid Smoke, Immersion Duration, Packaging and Long Storage different Levels of Antibacterials Nila Fish Fillet (Oreochromis … | International Journal of ChemTech Research 10 (15), 317-331, 2017 | 0 | 2017 | |
| 151 | Google Scholar | Authors : IK Budaraga | Effect of Combination Treatment of Concentration Liquid Smoke, Immertion Duration, Packaging and old Type Storagedifferent Levels of Protein Nila Fish Fillet (Oreochromis … | International Journal of ChemTech Research, 01-10 | 2 | 2017 | |
| 152 | Google Scholar | Authors : YMS Asnurita, IK Budaraga | Pengaruh konsentrasi starter Acetobacter xylinum terhadap mutu nata de cucumber | Jurnal pertanian UMSB 1 (2), 2017 | 6 | 2017 | |
| 153 | Google Scholar | Authors : IK Budaraga | Effect of Combination Treatment of Liquid Smoke Concentration, Soaking Time, Packaging and Different Storage Time To Yield And Moisture Contentnila Fish Fillet (... | International Journal of ChemTech Research 10 (Vol.10 No.1 pp 77-88, 2017 … | 1 | 2017 | |
| 154 | Google Scholar | Authors : IK Budaraga | Pengabdian Kepada Masyarakat Pembuatan Ramuan Organik Hama Dikawasan Ekonomi Masyarakat (KEM) Tikalak Kecamatan X Koto Singkarak Kabupaten Solok | 0 | 2017 | ||
| 155 | Google Scholar | Authors : Y Oktavia, IK Budaraga, L Hermalena | KAJIAN MUTU MINUMAN SEGAR CORENS DENGAN PENGGUNAAN BERBAGAI JENIS JERUK | UNES Journal Mahasiswa Pertanian 1 (1), 009-020, 2017 | 0 | 2017 | |
| 156 | Google Scholar | Authors : IK Budaraga | Effect of Combination Treatment of Concentration Liquid Smoke, Immersion Duration, Packaging and Long Storage different Levels of Antioxidant Tilapia Fish Fillet (Oreochromis … | International Journal of ChemTech Research 10 (nomor 15), 332-343, 2017 | 3 | 2017 | |
| 157 | Google Scholar | Authors : IK Budaraga | Pengabdian kepada masyarakat pembuatan ramuan organic tanaman (ROTAN) di kawasan ekonomi masyarakat (KEM) di Kanagarian Tikalak Kecamatan X Koto Singkarak Kabupaten Solok | UNES Journal of Community Service 2 (2), 45-54, 2017 | 0 | 2017 | |
| 158 | Google Scholar | Authors : S Syamsuwirman, IK Budaraga, T Tukiran | EFFECT OF GRANTING FEED OF NPK FERTILIZER FERTILIZER TO GROWTH AND RESULT CAISIM PLANT (Brassica Juncea L) | UNES Journal Of Scientech research 2 (2), 218-228, 2017 | 0 | 2017 | |
| 159 | Google Scholar | Authors : IK Budaraga | Penyuluhan Pemanfaatan Asap Cair Kulit Kakao Sebagai Pestisida Alami Pada Tanaman Kakao Di Kelompok Tani Aulia Natural Di Kabupaten Padang Pariaman | 0 | 2017 | ||
| 160 | Google Scholar | Authors : IK Budaraga | Effect of Combination Treatment of Concentration Liquid Smoke, Immertion Duration, Packaging and old Type Storagedifferent Levels of Protein Nila Fish Fillet (Oreochromis niloticus) | International Journal of ChemTech Research, 01-10 | 0 | 2017 | |
| 161 | Google Scholar | Authors : IK Budaraga | Effect of Combination Treatment of Concentration Liquid Smoke, Immersion Duration, Packaging and Long Storage different Levels of Antibacterials Nila Fish Fillet (Oreochromis … | International Journal of ChemTech Research 10 (15), 317-331, 2017 | 0 | 2017 | |
| 162 | Google Scholar | Authors : IK Budaraga | Effect of Combination Treatment of Concentration Liquid Smoke, Immersion Duration, Packaging and Long Storage different Levels of Antioxidant Tilapia Fish Fillet (Oreochromis … | International Journal of ChemTech Research 10 (nomor 15), 332-343 | 2 | 2017 | |
| 163 | Google Scholar | Authors : IK Budaraga | PENGABDIAN KEPADA MASYARAKAT PEMBUATAN RAMUAN ORGANIK TANAMAN (ROTAN) DIKAWASAN EKONOMI MASYARAKAT (KEM) KANAGARIAN TIKALAK KECAMATAN X KOTO SINGKARAK KABUPATEN SOLOK | UNES Journal of Community Service 2 (2), 127-134, 2017 | 0 | 2017 | |
| 164 | Google Scholar | Authors : IKB Gusriati 1), Armia2) | ESTABLISHING ORGANIC RICE PRODUCTION: TECHNICAL, ECONOMIC AND SOCIAL CONSTRAINTS (Case Study on Organic Farmers in Nagari Sariek Alahan... | UNES Journal Agricultural Scienties 1 (2), 167-175 | 0 | 2017 | |
| 165 | Google Scholar | Authors : IK Budaraga, W Winda, D Prima Putra | Study about Some Quality of Green Tea Ground with Addition of Red Ginger Powder (Zingiber Officinale Rosc) | International Journal of Life Sciences Research 5 (3), 8-17, 2017 | 0 | 2017 | |
| 166 | Google Scholar | Authors : IK Budaraga | Rice Intelligent From Making Mocaf (Modified Cassava Flour) | Universitas Ekasakti Padang (International Conference on Global Education V …, 2017 | 0 | 2017 | |
| 167 | Google Scholar | Authors : G Gusriati, A Armia, IK Budaraga | ESTABLISHING ORGANIC RICE PRODUCTION: TECHNICAL, ECONOMIC AND SOCIAL CONSTRAINTS (Case Study on Organic Farmers in Nagari Sariek Alahan Tigo, Hiliran Gumanti Sub-District … | UNES Journal of Agricultural Scienties 1 (2), 167-175 | 0 | 2017 | |
| 168 | Google Scholar | Authors : IK Budaraga, A Arnim, Y Marlinda, U Bulain | Liquid smoke production quality from raw materials variation and different pyrolysis temperature | International Journal on Advanced Science, Engineering and Information …, 2016 | 81 | 2016 | |
| 169 | Google Scholar | Authors : IK Budaraga, YM Arnim | Usman Bulanin. 2016. Liquid Smoke Production Quality from Raw Materials Variation and Different Pyrolysis Temperature | International Journal of ChemTech Research 6 (3), 2016 | 4 | 2016 | |
| 170 | Google Scholar | Authors : W Budaraga IK, Rahmita, Gusriati, Leffy Hermalena | Study on the Use of Green Bean as Skim Milk Substitution in Yellow Pumpkin (Cucurbita maxima) Ice Cream | Proceedings of AESAP 2016 1 (-), 15-27, 2016 | 0 | 2016 | |
| 171 | Google Scholar | Authors : IK Budaraga | Disertasi POTENSI ASAP CAIR DARI BERBAGAI SUMBER DAN APLIKASINYA SEBAGAI PENGAWET FILLET IKAN NILA (Oreochromis nilotica) | Ilmu Pertanian program pasca sarjana Universitas Andalas, 2016 | 0 | 2016 | |
| 172 | Google Scholar | Authors : A BudaragaIK, UB YettiMarlida | Antioxidant Properties of Liquid Smoke Cinnamon Production of Variation Purification and Different Concentration | International Journal of Scientific & Technology Research (IJSTR). ISSN ISSN … | 3 | 2016 | |
| 173 | Google Scholar | Authors : IK Budaraga, YM Arnim | Usman Bulanin,. 2016. Analysis Of Liquid Smoke Chemical Components With GC MS From Differenft Raw Materials Variation Production And Pyrolysis Temperature Level | International Journal of ChemTech Research 9 (6), 2016 | 4 | 2016 | |
| 174 | Google Scholar | Authors : B USMAN | Liquid Smoke Toxicity Characteristic from raw Materials Variation Production with Different Temperature and Concentration Level | International Journal of Agricultural Technology 12 (6), 1017-1034, 2016 | 0 | 2016 | |
| 175 | Google Scholar | Authors : UB I Ketut Budaraga,Arnim,YettiMarlida | Effect Combination Treatment Different Concentration of Liquid Smoke, Immersion Duration, Packaging and Storage Duration to Organoleptic quality Fillet Tilapia Fish (Oreochromisniloticus) | International Journal of Advanced Scientific and Technical Research Issue 6 ... | 0 | 2016 | |
| 176 | Google Scholar | Authors : IK Budaraga | Pembuatan Pakan Ternak Sapi Dari Jerami Menggunakan Ramuan Organik Ternak (Roter) Sebagai Salah Satu Perwujudan Kegiatan Kkn-Ppm Pertanian Terintegrasi Di Kanagarian Kasang … | 0 | 2016 | ||
| 177 | Google Scholar | Authors : IK Budaraga, A Arnim, Y Marlinda, U Bulain | Liquid smoke production quality from raw materials variation and different pyrolysis temperature | International Journal on Advanced Science, Engineering and Information …, 2016 | 81 | 2016 | |
| 178 | Google Scholar | Authors : W Budaraga IK, Rahmita, Gusriati, Leffy Hermalena | Study on the Use of Green Bean as Skim Milk Substitution in Yellow Pumpkin (Cucurbita maxima) Ice Cream | Proceedings of AESAP 2016 1 (-), 15-27, 2016 | 0 | 2016 | |
| 179 | Google Scholar | Authors : B I Ketut, Arnim, M Yetti, B Usman | Effect Combination Treatment Different Concentration of Liquid Smoke, Immersion Duration, Packaging and Storage Duration to Organoleptic quality Fillet Tilapia Fish … | International Journal of Advanced Scientific and Technical Research 6 (2 … | 1 | 2016 | |
| 180 | Google Scholar | Authors : IK Budaraga | Effect Combination Treatment Different Concentration of Liquid Smoke, Immersion Duration, Packaging and Storage Duration to Organoleptic quality Fillet Tilapia Fish … | International Journal of Advanced Scientific and Technical Research 2 (6 …, 2016 | 3 | 2016 | |
| 181 | Google Scholar | Authors : UB I Ketut Budaraga,Arnim,YettiMarlida | Effect Combination Treatment Different Concentration of Liquid Smoke, Immersion Duration, Packaging and Storage Duration to Organoleptic quality Fillet Tilapia Fish (Oreochromisniloticus) | International Journal of Advanced Scientific and Technical Research Issue 6 ... | 0 | 2016 | |
| 182 | Google Scholar | Authors : IK Budaraga | Pembuatan Pakan Ternak Sapi Dari Jerami Menggunakan Ramuan Organik Ternak (Roter) Sebagai Salah Satu Perwujudan Kegiatan Kkn-Ppm Pertanian Terintegrasi Di Kanagarian Kasang … | 0 | 2016 | ||
| 183 | Google Scholar | Authors : IK Budaraga, YM Arnim | Usman Bulanin,. 2016. Antioxidant Properties of Liquid Smoke Cinnamon Production of Variation Purification and Different Concentration | International Journal of Scientific & Technology Research (IJSTR). ISSN ISSN …, 2016 | 5 | 2016 | |
| 184 | Google Scholar | Authors : IK Budaraga, A Arnim, Y Marlinda, U Bulain | Liquid smoke production quality from raw materials variation and different pyrolysis temperature | International Journal on Advanced Science, Engineering and Information …, 2016 | 81 | 2016 | |
| 185 | Google Scholar | Authors : IK Budaraga | Study On The Use Of Green Bean As Skim Milk Substitution In Yellow Pumpkin (Cucurbita Maxima) | UNES Journal Of Community Service 2 (2), 2016 | 0 | 2016 | |
| 186 | Google Scholar | Authors : W Budaraga IK, Rahmita, Gusriati, Leffy Hermalena | Study on the Use of Green Bean as Skim Milk Substitution in Yellow Pumpkin (Cucurbita maxima) Ice Cream | Proceedings of AESAP 2016 1 (-), 15-27, 2016 | 0 | 2016 | |
| 187 | Google Scholar | Authors : B I Ketut, Arnim, M Yetti, B Usman | Effect Combination Treatment Different Concentration of Liquid Smoke, Immersion Duration, Packaging and Storage Duration to Organoleptic quality Fillet Tilapia Fish … | International Journal of Advanced Scientific and Technical Research 6 (2 … | 1 | 2016 | |
| 188 | Google Scholar | Authors : IK Budaraga | Effect Combination Treatment Different Concentration of Liquid Smoke, Immersion Duration, Packaging and Storage Duration to Organoleptic quality Fillet Tilapia Fish … | International Journal of Advanced Scientific and Technical Research 2 (6 …, 2016 | 3 | 2016 | |
| 189 | Google Scholar | Authors : IK Budaraga, A Arnim, Y Marlinda, U Bulain | Antibacterial Properties of Liquid Smoke from the Production of Cinnamon How Purification and Concentration of Different | International Journal of Thesis Projects and Dissertations (IJTPD) 4 (2 …, 2016 | 10 | 2016 | |
| 190 | Google Scholar | Authors : IK Budaraga, A Arnim, Y Marlinda, U Bulain | Antioxidant properties of liquid smoke production variation of pyrolysis temperature raw and different concentration | Journal of PharmTech Research 9 (6), 366-379, 2016 | 9 | 2016 | |
| 191 | Google Scholar | Authors : IK Budaraga | Pembuatan Pakan Ternak Sapi Dari Jerami Menggunakan Ramuan Organik Ternak (Roter) Sebagai Salah Satu Perwujudan Kegiatan Kkn-Ppm Pertanian Terintegrasi Di Kanagarian Kasang … | 0 | 2016 | ||
| 192 | Google Scholar | Authors : IK Budaraga, A Arnim, Y Marlinda, U Bulain | Liquid smoke production quality from raw materials variation and different pyrolysis temperature | International Journal on Advanced Science, Engineering and Information …, 2016 | 81 | 2016 | |
| 193 | Google Scholar | Authors : W Budaraga IK, Rahmita, Gusriati, Leffy Hermalena | Study on the Use of Green Bean as Skim Milk Substitution in Yellow Pumpkin (Cucurbita maxima) Ice Cream | Proceedings of AESAP 2016 1 (-), 15-27, 2016 | 0 | 2016 | |
| 194 | Google Scholar | Authors : B I Ketut, Arnim, M Yetti, B Usman | Effect Combination Treatment Different Concentration of Liquid Smoke, Immersion Duration, Packaging and Storage Duration to Organoleptic quality Fillet Tilapia Fish … | International Journal of Advanced Scientific and Technical Research 6 (2 … | 1 | 2016 | |
| 195 | Google Scholar | Authors : IK Budaraga | Effect Combination Treatment Different Concentration of Liquid Smoke, Immersion Duration, Packaging and Storage Duration to Organoleptic quality Fillet Tilapia Fish … | International Journal of Advanced Scientific and Technical Research 2 (6 …, 2016 | 3 | 2016 | |
| 196 | Google Scholar | Authors : IK Budaraga | Arnim; Marlida, Y.; Bulanin, U., Analysis of liquid smoke chemical components with GC MS from different raw materials variation production and pyrolysis temperature level | Int. J. ChemTech Res 9, 694-708, 2016 | 3 | 2016 | |
| 197 | Google Scholar | Authors : IK Budaraga, A Arnim, Y Marlinda, U Bulain | Antibacterial Properties of Liquid Smoke from the Production of Cinnamon How Purification and Concentration of Different | International Journal of Thesis Projects and Dissertations (IJTPD) 4 (2 …, 2016 | 10 | 2016 | |
| 198 | Google Scholar | Authors : IK Budaraga, A Arnim, Y Marlinda, U Bulain | Antioxidant properties of liquid smoke production variation of pyrolysis temperature raw and different concentration | Journal of PharmTech Research 9 (6), 366-379, 2016 | 9 | 2016 | |
| 199 | Google Scholar | Authors : A Aisyah, G Gusriati, IK Budaraga | FAKTOR-FAKTOR YANG MEMPENGARUHI PRODUKSI KARET (Havea brasiliensis) DI KABUPATEN PASAMAN PROVINSI SUMATERA BARAT | UNES Journal of Scientech Research 1 (1), 065-074, 2016 | 1 | 2016 | |
| 200 | Google Scholar | Authors : H Gusvita, IK Budaraga | Analysis Of Factors Affecting Demand Red Chili Pepper Capsicum Annum L In Solok And Effort Fulfillment | International Journal of Scientific & Technology Research 4 (8), 159-173, 2015 | 0 | 2015 | |
| 201 | Google Scholar | Authors : H Gusvita, IK Budaraga | Analysis Of Factors Affecting Demand Red Chili Pepper Capsicum Annum L In Solok And Effort Fulfillment | International Journal of Scientific & Technology Research 4 (8), 159-173, 2015 | 0 | 2015 | |
| 202 | Google Scholar | Authors : L Permana, L Suhendra | Optimasi konsentrasi VCO dalam mikroemulsi O/W dengan tiga surfaktan sebagai pembawa senyawa bioaktif | Media Ilm. Teknol. Pangan 2, 106-114, 2015 | 8 | 2015 | |
| 203 | Google Scholar | Authors : I Permana, L Suhendra, KB Jimbaran | OPTIMASI KONSENTRASI VCO DALAM MIKROEMULSI O/W DENGAN TIGA SURFACTANT SEBAGAI PEMBAWA SENYAWA BIOAKTIF | Media Ilmiah Teknologi Pangan (Scientific Journal of Food Technology) 2 (2 … | 2 | 2015 | |
| 204 | Google Scholar | Authors : Y I Ketut Budaraga | Penerapan Iptek Bagi Masyarakat bagi Petani Tebu dan Sarunai Maimbau Di Korong Batang Selasih Kanagarian Bukit Batabuah Kecamatan Canduang Kabupaten Agam | Menara ilmu 220 (Vol 9 j. 1 No.62 Okt 2015 ISSN 1693-2617), 190-205, 2015 | 0 | 2015 | |
| 205 | Google Scholar | Authors : I Permana, L Suhendra | Optimasi konsentrasi VCO dalam mikroemulsi m/a dengan tiga surfaktan sebagai pembawa senyawa bioaktif | Media Ilmiah Teknologi Pangan (Scientific Journal of Food Technology) 2 (2 … | 2 | 2015 | |
| 206 | Google Scholar | Authors : IK Budaraga, A Fridarti, E Usnel | Cattle cow dung use as an alternative energy source and organic fertilizer friendly enviroment village Kasang districts Batang Anai Padang Pariaman | Int J Sci Technol Res 4 (8), 171-175, 2015 | 3 | 2015 | |
| 207 | Google Scholar | Authors : G Zulfitriyana, H Gusvita, IK Budaraga | Analysis Of Factors Affecting Demand Red Chili Pepper (Capsicum Annum L) In Solok And Effort Fulfillment | Int. J. Sci. Technol. Res 4 (8), 2015 | 3 | 2015 | |
| 208 | Google Scholar | Authors : IK Budaraga, Y Yurnalis | Penerapan Iptek Bagi Masyarakat Kepada Petani Tebu Sirangkak Gadang dan Sarunai Maimbau di Korong Batang Selasih Kanagarian Bukit Batabuah Kecamatan Canduang Kabupaten Agam | Jurnal Penelitian dan Kajian Ilmiah Menara Ilmu 9 (1), 180-190, 2015 | 0 | 2015 | |
| 209 | Google Scholar | Authors : Y I Ketut Budaraga | Penerapan Iptek Bagi Masyarakat bagi Petani Tebu dan Sarunai Maimbau Di Korong Batang Selasih Kanagarian Bukit Batabuah Kecamatan Canduang Kabupaten... | Menara ilmu 220 (Vol 9 j. 1 No.62 Okt 2015 ISSN 1693-2617), 190-205 | 0 | 2015 | |
| 210 | Google Scholar | Authors : G I Ketut Budaraga | Kajian Mutu Mikrobiologi Filet Lele Asap yang diberi Asap Cair Kayu Manis | Ekasakti 143 (Vol.24.no.1 Januari 2014 ISSN 0854-8099), 92-108, 2014 | 0 | 2014 | |
| 211 | Google Scholar | Authors : G I Ketut Budaraga | Ibm Kelompok Tani Tagamang Bajawek di Kabupaten Padang Pariaman Sumbar | Menara Ilmu 140 (Vol.VIII No. 44 Jan.2014 ISSN 1693-2617), 57-66, 2014 | 0 | 2014 | |
| 212 | Google Scholar | Authors : IK Budaraga, R Abu | Rancang bangun alat pengering hasil perikanan menggunakan kompor briket tempurung kelapa | Laporan Penelitian Lembaga Penelitian dan Pengabdian Kepada Masyarakat …, 2014 | 5 | 2014 | |
| 213 | Google Scholar | Authors : RA I Ketut Budaraga | Peningkatan Pendapatan Masyarakat Melalui Pemanfaatan Briket Tempurung Kelapa,Kompor Briket dan Asap Cair Di Desa Sungai Rambai Kecamatan Pariaman Utara Kota PAriaman | Menara ilmu 121 (Vol VIII No.52 Sept 2014 ISSN 1693-2617), 35-49, 2014 | 0 | 2014 | |
| 214 | Google Scholar | Authors : G Budaraga I Ketut | Kajian Mutu Pillet Lele Asap yang Diberikan Asap Cair Kayu Manis | Buletin Ilmiah Ekasakti 26 (1), 0854-8099, 2014 | 0 | 2014 | |
| 215 | Google Scholar | Authors : RA I Ketut Budaraga | Peningkatan Pendapatan Masyarakat Melalui Pemanfaatan Briket Tempurung Kelapa,Kompor Briket dan Asap Cair Di Desa Sungai Rambai Kecamatan Pariaman... | Menara ilmu 121 (Vol VIII No.52 Sept 2014 ISSN 1693-2617), 35-49 | 0 | 2014 | |
| 216 | Google Scholar | Authors : IK Budaraga, G Gusriati | Ibm Kelompok Tani Tagamang Bajawek di Kabupaten Padang Pariaman | Jurnal Penelitian dan Kajian Ilmiah Menara Ilmu 3 (44), 52-57, 2014 | 0 | 2014 | |
| 217 | Google Scholar | Authors : IK Budaraga | Utilization Using Liquid Smoke Fish Fillet AsPservatives | International seminar global education 2 786 (Proceeding UNES dan UKM), 1-19, 2014 | 0 | 2014 | |
| 218 | Google Scholar | Authors : IK Budaraga | Utilization Using Liquid Smoke Fish Fillet As Preservatives | 1 | 2014 | ||
| 219 | Google Scholar | Authors : IK Budaraga, A Asnurita | IBM Kelompok Budidaya Ikan Maju Bersama | Jurnal Penelitian dan Kajian Ilmiah Menara Ilmu 8 (53), 37-43, 2014 | 0 | 2014 | |
| 220 | Google Scholar | Authors : G I Ketut Budaraga | Kajian Mutu Mikrobiologi Filet Lele Asap yang diberi Asap Cair Kayu Manis | Ekasakti 143 (Vol.24.no.1 Januari 2014 ISSN 0854-8099), 92-108, 2014 | 0 | 2014 | |
| 221 | Google Scholar | Authors : IK Budaraga, G Gusriati | Kajian Mutu Mikrobiologi Fillet Lele Asap yang diberi asap cair kayu manis | Buletin Ilmiah Ekasakti 26 (1), 92-108, 2014 | 0 | 2014 | |
| 222 | Google Scholar | Authors : IK Budaraga | Peningkatan Pendapatan Masyarakat Melalui Pemanfaatan Briket Tempurung Kelapa, Kompor Briket Dan Asap Cair Di Desa Sungai Rambai Kecamatan Pariaman Utara Kota Pariaman Provinsi … | Jurnal Penelitian dan Kajian Ilmiah Menara Ilmu 8 (52), 30-35, 2014 | 0 | 2014 | |
| 223 | Google Scholar | Authors : G I Ketut Budaraga | Ibm Kelompok Tani Tagamang Bajawek di Kabupaten Padang Pariaman Sumbar | Menara Ilmu 140 (Vol.VIII No. 44 Jan.2014 ISSN 1693-2617), 57-66, 2014 | 0 | 2014 | |
| 224 | Google Scholar | Authors : IK Budaraga, A Arnim, Y Marlinda, U Bulain | Antioxidant properties of liquid smoke cinnamon production of variation of purification and different concentration | International Journal of Scientific & Technology Research 5 (6), 266-273, 2013 | 12 | 2013 | |
| 225 | Google Scholar | Authors : IK Budaraga | Pendidikan Pemanfaatan Asap Cair Sebagai Pengawet Bahan Pangan yang Ramah Lingkungan | International Conference on Global Education 1, 24-36, 2013 | 2 | 2013 | |
| 226 | Google Scholar | Authors : gusriati I Ketut Budaraga | Kajian Mutu Filet Lele Asap yang diberikan Asap Cair Kayu Manis | Seminar Nasional Peranan Teknologi Pangan dan Gizi Dalam Meningkatkan Mutu …, 2013 | 0 | 2013 | |
| 227 | Google Scholar | Authors : J I Ketut Budaraga, Rizal Abu | Kompor Briket Tahan Panas | 0 | 2013 | ||
| 228 | Google Scholar | Authors : G I Ketut Budaraga | Ibm Kelompok Usaha Roda Banting dan Kelompok Tani Rambai Sakato di Kota Pariaman | Menara Ilmu 190 (Vol VIII no. 41 Okt 2013 ISSN 1693-2617), 38-43, 2013 | 0 | 2013 | |
| 229 | Google Scholar | Authors : G I Ketut Budaraga | Kajian Mutu Kimia Filet Lele Asap yang diberikan asap cair kayu manis | Ekasakti 126 (Volume XXIV No. 1 Januari 2013), 102-120, 2012 | 0 | 2012 | |
| 230 | Google Scholar | Authors : IK Budaraga | Dampak Bahaya Senyawa Benzoepiren yang terdapat dalam asap cair | Buletin Ilmiah Ekasakti 22 (1), 8-27, 2012 | 0 | 2012 | |
| 231 | Google Scholar | Authors : G I Ketut Budaraga | Kajian Mutu Kimia Filet Lele Asap yang diberikan asap cair kayu manis | Ekasakti 126 (Volume XXIV No. 1 Januari 2013), 102-120, 2012 | 0 | 2012 | |
| 232 | Google Scholar | Authors : IK Budaraga | Dampak Bahaya Senyawa Benzoepiren yang terdapat dalam asap cair | Buletin Ilmiah Ekasakti 22 (1), 8-27, 2012 | 0 | 2012 | |
| 233 | Google Scholar | Authors : IK Budaraga | Potensi, Permasalahan, Tantangan Dan Strategi Pembangunan Pertanian Ke Depan | Jurnal Ekotrans 12 (2), 1-17, 2012 | 0 | 2012 | |
| 234 | Google Scholar | Authors : G I Ketut Budaraga,Rizal Abu | Inovation Cocunut Shell Briquette Production Stove As Alternative Substitution of Fuel Oil In Pariaman | Ekotrans 189 (Vol 11 No.1.Jan 2011 ISSN 1411-4615), 189, 2011 | 0 | 2011 | |
| 235 | Google Scholar | Authors : IK Budaraga | Uji Kinerja Alat dan Identifikasi Produk Asap Cair Kayu Manis Pada Berbagai Waktu Pirolisis dan Cara Pemurnian Untuk Pengawet Filet Ikan Nila (Oreochromis nilotica) | Buletin Ilmiah Ekasakti 20 (1), 137-165, 2011 | 0 | 2011 | |
| 236 | Google Scholar | Authors : IK Budaraga | Innovation Coconut Shell Briquette Stove as Alternative Substitution of Fuel Oil in Pariaman | Jurnal Ekotrans Jurnal Pemikiran dan Analisis masalah Ekologi dan …, 2011 | 0 | 2011 | |
| 237 | Google Scholar | Authors : IK Budaraga | Potensi Pemanfaatan Asap Cair Sebagai Pengawet Bahan Pangan | Jurnal Ekotrans: Jurnal Pemikiran Dan Analisis Masalah Ekologi Dan …, 2011 | 1 | 2011 | |
| 238 | Google Scholar | Authors : IK Budaraga | Pemanfaatan Air Kelapa Menjadi Produk Olahan Kecap dan Kesehatan | Buletin Ilmiah Ekasakti 20 (1), 66-70, 2011 | 0 | 2011 | |
| 239 | Google Scholar | Authors : IK Budaraga | Pemanfaatan Air Kelapa menjadi produk kecap dan kesehatan | Buletin Ilmiah EKASAKTI 20 (1), 66-70, 2011 | 0 | 2011 | |
| 240 | Google Scholar | Authors : IK Budaraga | Pengenalan Sistem Penerapan Pertanian Organik Pada Masyarakat | Buletin Ilmiah Ekasakti 21 (2), 1-14, 2011 | 0 | 2011 | |
| 241 | Google Scholar | Authors : IK Budaraga | Pengenalan Sistem Penerapan Pertanian Organik Pada Masyarakat | Buletin Ilmiah Ekasakti 21 (2), 1-14, 2011 | 0 | 2011 | |
| 242 | Google Scholar | Authors : IK Budaraga | Potensi Pemanfaatan Asap Cair Sebagai Pengawet Bahan Pangan | Jurnal Ekotrans: Jurnal Pemikiran Dan Analisis Masalah Ekologi Dan …, 2011 | 1 | 2011 | |
| 243 | Google Scholar | Authors : IK Budaraga | Percepatan Difusi dan Pemanfaatan Iptek Penerapan Inovasi Bioteknologi NT 45 dalam Penglolaan Tambak Air Payau Untuk peningkatan Pendapatan Masyarakat... | Ekontrans 186 (Vol.10 No.2 Juli 2010 ISSN 1411-4615), 164-176 | 0 | 2010 | |
| 244 | Google Scholar | Authors : IK Budaraga | Strategi dan Peluang Pemanfaatan Teknologi Tepat Guna (TTG) dalam Meningkatkan Usaha Masyarakat | Ekasakti 131 (Vol.19 No.2 Juli 2010 ISSN 0854-8099), 13-38, 2010 | 0 | 2010 | |
| 245 | Google Scholar | Authors : IK Budaraga | Percepatan Difusi dan Pemanfaatan Iptek Pengolahan Tempurung Kelapa Menjadi Briket sebagai Alternatif Pengganti BBM di Kota Pariaman Provinsi Sumatera Barat | Jurnal Ekotrans Jurnal Pemikiran dan Analisis masalah Ekologi dan …, 2010 | 0 | 2010 | |
| 246 | Google Scholar | Authors : IK Budaraga | Pemanfaatan Asap Cair Tempurung Kelapa sebagai Pengawet Ikan Teri di Kelurahan Pasie Nan Tigo Kecamatan Koto Tangah Kota Padang | Jurnal Ekotrans Jurnal Pemikiran dan Analisis masalah Ekologi dan …, 2010 | 0 | 2010 | |
| 247 | Google Scholar | Authors : IK Budaraga | Percepatan Difusi dan Pemanfaatan iptek Pengolahan Tempurung kelapa Menjadi Briket Sebagai Alternatif Pengganti BBM di Kota Pariaman Provinsi Sumatera Ba... | Ekotrans 186 (Vol.10 No.2 Juli 2010 ISSN 1411-4615), 71-87 | 0 | 2010 | |
| 248 | Google Scholar | Authors : IK Budaraga | Percepatan Difusi dan Pemanfaatan Iptek Penerapan Inovasi Bioteknologi NT 45 dalam Penglolaan Tambak Air Payau Untuk peningkatan Pendapatan Masyarakat di Daerah Pesisir | Ekontrans 186 (Vol.10 No.2 Juli 2010 ISSN 1411-4615), 164-176, 2010 | 0 | 2010 | |
| 249 | Google Scholar | Authors : MS Ir. I Ketut Budaraga | Inovasi Teknologi Pembuatan briket dari Tempurung Kelapa Sebagai Alternatif Pengganti BBM di Kota Pariaman | Buletin Iptekda LIPI 33 (Edisi Khusus Nov.2009 ISSN 1411-6707), 16-18, 2009 | 0 | 2009 | |
| 250 | Google Scholar | Authors : IK Budaraga | Potensi Tempurung Sawit Sebagai Bahan Baku Pembuatan Briket, Arang Aktif, Fenol Dan Asap Cair | Buletin Ilmiah Ekasakti 16 (1), 78-93, 2009 | 0 | 2009 | |
| 251 | Google Scholar | Authors : D I Ketut Budaraga | Teknologi Pembuatan Pupuk Organik Majemuk Lengkap dengan Memanfaatkan Bioteknologi NT 45 | Ekotrans 183 (Vol 9 No. 2 Juli 2009 ISSN 1411-4615), 21-27, 2009 | 0 | 2009 | |
| 252 | Google Scholar | Authors : IK Budaraga | Potensi Tempurung Sawit Sebagai Bahan Baku Pembuatan Briket, Arang Aktif, Fenol Dan Asap Cair | Buletin Ilmiah Ekasakti 16 (1), 78-93, 2009 | 0 | 2009 | |
| 253 | Google Scholar | Authors : IK Budaraga | Kombinasi penambahan tepung karagenan dengan alkali terhadap terhadap beberapa kualitas bakso ikan tenggiri | Ekasakti 134 (Vol.16 No.1 Jan.2009 ISSN 0854-8099), 78-93, 2009 | 0 | 2009 | |
| 254 | Google Scholar | Authors : IK Budaraga | Potensi pemanfaatan Tempurung Sawit sebagai Bahan Baku Pembuatan Briket,Arang Aktif,Fenol dan Asap Cair | Ekotrans 183 (Vol 9 No.2 Juli 2009), 56-65, 2009 | 0 | 2009 | |
| 255 | Google Scholar | Authors : nursal idris I Ketut Budaraga,Darmansyah, abdul razal | Percepatan difusi dan pemanfaatan iptek penerapan bioteknologi NT 45 di Bidang Budidaya Perikanan pada Kolam Pendederan Terhadap Pertumbuhan Bibit Ikan Nila | aquaculture 2008 Indonesia Partnership and Inovation for Sustanainable …, 2008 | 0 | 2008 | |
| 256 | Google Scholar | Authors : nursal idris I Ketut Budaraga,Darmansyah, abdul razal | Percepatan difusi dan pemanfaatan iptek penerapan bioteknologi NT 45 di Bidang Budidaya Perikanan pada Kolam Pendederan Terhadap Pertumbuhan Bibit Ikan... | aquaculture 2008 Indonesia Partnership and Inovation for Sustanainable … | 0 | 2008 | |
| 257 | Google Scholar | Authors : IK Budaraga | Prospek Tepung Sukun Untuk Berbagai Produk Makanan Olahan Dalam Upaya Menunjang Diversifikasi Pangan | Jurnal Ekotrans: Jurnal Pemikiran Dan Analisis Masalah Ekologi Dan …, 2008 | 0 | 2008 | |
| 258 | Google Scholar | Authors : gusriati I Ketut Budaraga | Pengaruh Pemberian Berbagai Konsentrasi Asap Cair Tempurung Kelapa Terhadap Mutu Pengolahan Ikan Teri dalam Rangka Peningkatan Kualitas Hasil Perikanan di Kabupaten Pesisir Selatan | SIGMATEK (Jurnal Sains dan Teknologi) 256 (Vol.2 N.2 Sept.2008 ISSN 1978 …, 2008 | 0 | 2008 | |
| 259 | Google Scholar | Authors : gusriati I Ketut Budaraga | Pengaruh Pemberian Berbagai Konsentrasi Asap Cair Tempurung Kelapa Terhadap Mutu Pengolahan Ikan Teri dalam Rangka Peningkatan Kualitas Hasil Perikan... | SIGMATEK (Jurnal Sains dan Teknologi) 256 (Vol.2 N.2 Sept.2008 ISSN 1978 … | 0 | 2008 | |
| 260 | Google Scholar | Authors : IK Budaraga | Tempurung Kelapa Untuk Mengawetkan Ikan | Jurnal: Samudra 6 (64), 26-27, 2008 | 0 | 2008 | |
| 261 | Google Scholar | Authors : IK Budaraga | Performance Characteristics Of Cocoa Skin Liquid Smokersin Different Water Content Conditions | inter 10 (15), 2001 | 0 | 2001 | |
| 262 | Google Scholar | Authors : IK Budaraga | Strategi Dan Peluang Pemanfaatan Teknologi Tepat Guna (TTG) Dalam Meningkatkan Usaha Masyarakat | Buletin Ilmiah Ekasakti 19 (2), 13-38, 2001 | 0 | 2001 | |
| 263 | Google Scholar | Authors : | 0 | 2000 | |||
| 264 | Google Scholar | Authors : IK Budaraga | Pengkajian respirasi buah mangga dan salak terolah minimal selama penyimpanan | IPB (Bogor Agricultural University), 1998 | 3 | 1998 | |
| 265 | Google Scholar | Authors : IK Budaraga | Tesis Pengkajian Respirasi Buah Mangga dan Salak Terolah Minimal Selama Penyimpanan | Program Studi Teknik Pasca Panen Institut Pertanian Bogor, 1998 | 0 | 1998 | |
| 266 | Google Scholar | Authors : IK Budaraga | Skripsi Pengaruh Blanching dan Pemberian Natrium Metabisulfit Terhadap Beberapa komponen Mutu Tepung Pisang Kepok (musa parasidiaca) | Universitas Mataram, 1992 | 0 | 1992 | |
| 267 | Google Scholar | Authors : IK Budaraga | Effect of Combination Treatment of Liquid Smoke Concentration, Soaking Time, Packaging and Different Storage Time To Yield And Moisture Contentnila Fish Fillet | 0 | 0000 | ||
| 268 | Google Scholar | Authors : IK Budaraga | BAB 4 ILMU SAGU | ILMU PANGAN JILID, 53, 0 | 0 | 0000 | |
| 269 | Google Scholar | Authors : RAGA SALIHAT, IK BUDARAGA, D SYUKRI, NR YANTI, EA FITRIA | The Effect of Addition of Wuluh Starfruit (Averrhoa bilimbi L.) Juice as a Coagulant in Cottage Cheese from Cow’s Milk | 0 | 0000 | ||
| 270 | Google Scholar | Authors : IK Budaraga, YM Arnim | Usman Bulanin,. 2016. Antioxidant Properties of Liquid Smoke Production Variation of Pyrolysis Temperature Raw and Different Concentration | International Journal of PharmTech Research 9 (6), 366-379, 0 | 8 | 0000 | |
| 271 | Google Scholar | Authors : G Zulfitriyana, H Gusvita, IK Budaraga | Analysis Of Factors Affecting Demand Red Chili Pepper (Capsicum Annum L) In Solok And Effort Fulfillment | 0 | 0000 | ||
| 272 | Google Scholar | Authors : EA Fitria, IK Budaraga, S Zebua | Pengujian Asam Lemak Bebas Pada Wajik Yang Dilapisi Edible Film Khitosan-PVA | Sagu 21 (1), 38-42, 0 | 0 | 0000 | |
| 273 | Google Scholar | Authors : IK Budaraga | BAB 2 ILMU SUSU | ILMU PANGAN JILID 2, 15, 0 | 0 | 0000 | |
| 274 | Google Scholar | Authors : IK Budaraga, EA Murnita | Penyuluhan Manfaat Penerapan Pertanian Organik Di Kelompok Tani Kampung Apar Nagari Se Buluh Kecamatan Batang Anai Kabupaten Padang Pariaman | Seminar Nasional Sosial Ekonomi 2019, 93, 0 | 0 | 0000 | |
| 275 | Google Scholar | Authors : RA Salihat | Heavy metals analysis (Cd, Pb, Zn, Cu, Cr) and Calcium in Padang and Padang Panjang | 0 | 0000 | ||
| 276 | Google Scholar | Authors : ENM Lubis, G Ali, R Wikansari, RPA Hasibuan, A Dilham, MUM Putra, ... | No Title Page | 0 | 0000 | ||
| 277 | Google Scholar | Authors : I Ketut Budaraga, M Arnim | Y., & Bulanin, U.(2016). Analysis of liquid smoke chemical components with GC MS from different raw materials variation production and pyrolysis temperaturelevel | International Journal of ChemTech Research 9 (6), 694-708, 0 | 5 | 0000 | |
| 278 | Google Scholar | Authors : IK Budaraga, YM Arnim | Usman Bulanin,. 2016. Antibacterial Properties of Liquid Smoke from the Production of Cinnamon How Purification and Concentration of Different | International Journal of Thesis Projects and Dissertations (IJTPD) Vol 4 …, 0 | 5 | 0000 | |
| 279 | Google Scholar | Authors : IK Budaraga, EA Murnita | Penyuluhan Manfaat Penerapan Pertanian Organik Di Kelompok Tani Kampung Apar Nagari Se Buluh Kecamatan Batang Anai Kabupaten Padang Pariaman | Seminar Nasional Sosial Ekonomi 2019, 93 | 1 | 0000 | |
| 280 | Google Scholar | Authors : IK Budaraga | Effect of Combination Treatment of Liquid Smoke Concentration, Soaking Time, Packaging and Different Storage Time To Yield And Moisture Contentnila Fish Fillet | 0 | 0000 | ||
| 281 | Google Scholar | Authors : IK Budaraga, L Hermalena, WR Saputra | KAJIAN SIFAT FISIKOKIMIA DAN ORGANOLEPTIK SUSU SAPI MURNI DENGAN PENAMBAHAN ASAP CAIR SELAMA PENYIMPANAN | 0 | 0000 | ||
| 282 | Google Scholar | Authors : IK Budaraga, E Susanti | Study of Toxicity of Cacao Skin Liquid (Theobroma cacao, L) Using BSLT Method (Brine Shrimp Lethality Test) | 0 | 0000 | ||
| 283 | Google Scholar | Authors : BK Lahati, Y Nurmayanti, U Pato, STC Murti, IK Budaraga, HJD Lalel, ... | KEAMANAN PANGAN | 0 | 0000 | ||
| 284 | Google Scholar | Authors : ENM Lubis, G Ali, R Wikansari, RPA Hasibuan, A Dilham, MUM Putra, ... | No Title Page | 0 | 0000 | ||
| 285 | Google Scholar | Authors : Y Mayang Sari | Ketut Budaraga Universitas Ekasakti AI 2017 Pengaruh konsentrasi starter acetobacter xylinum terhadap mutu nata de cucumber | J. Pertan. UMSB 1, 2527-3663, 0 | 2 | 0000 | |
| 286 | Google Scholar | Authors : IK Budaraga | Utilization Using Liquid Smoke Fish Fillet As Preservatives | 0 | 0000 | ||
| 287 | Google Scholar | Authors : IK Budaraga, RA Salihat | Antioxidant Activity of ‘Broken Skin’Purple Rice,‘Skinned’Purple Rice, and Purple Rice Stem Organically Cultivated in Indonesia | 1 | 0000 | ||
| 288 | Google Scholar | Authors : IK Budaraga, YM Arnim | Usman Bulanin,. 2016. Liquid Smoke Toxicity Properties of Production of Raw Materials With Variation of Temperature and Concentration of Different | International Journal of PharmTech Research 9 (10), 0 | 9 | 0000 | |
| 289 | Google Scholar | Authors : IK Budaraga, Y Oktavia, L Hermalena | Study of the Quality chemical of Fresh Drinks Corens with the Use of Different Types of Oranges | 0 | 0000 | ||
| 290 | Google Scholar | Authors : IK Budaraga, R Abu | Jamaludin, 2013 | Kompor Briket Tahan Panas (Paten no. ID S0001244 tanggal 19 Maret 2013 …, 0 | 5 | 0000 | |
| 291 | Google Scholar | Authors : IK Budaraga | BAB 4 ILMU SAGU | ILMU PANGAN JILID, 53, 0 | 0 | 0000 | |
| 292 | Google Scholar | Authors : RAGA SALIHAT, IK BUDARAGA, D SYUKRI, NR YANTI, EA FITRIA | The Effect of Addition of Wuluh Starfruit (Averrhoa bilimbi L.) Juice as a Coagulant in Cottage Cheese from Cow’s Milk | 0 | 0000 | ||
| 293 | Google Scholar | Authors : IK Budaraga, YM Arnim | Usman Bulanin,. 2016. Antioxidant Properties of Liquid Smoke Production Variation of Pyrolysis Temperature Raw and Different Concentration | International Journal of PharmTech Research 9 (6), 366-379, 0 | 8 | 0000 | |
| 294 | Google Scholar | Authors : M Sari | Yenti, and Asnurita I dan Ketut Budaraga Universitas Ekasakti. 2017 | Pengaruh Konsentrasi Starter Acetobacter Xylinum Terhadap Mutu Nata De …, 0 | 0 | 0000 | |
| 295 | Google Scholar | Authors : IK Budaraga, S Syafrudin, G Gusriati, W Sumarno | Pelatihan Pemanfaatan Limbah Kelapa (Lidi) Menjadi Kerajinan Tangan di Nagari IV Koto Mudik Kecamatan Batang Kapas Kabupaten Pesisir Selatan | Buletin Udayana Mengabdi 18 (3) | 0 | 0000 | |
| 296 | Google Scholar | Authors : N Nordin, M Tan, AN Latfa, P Tambahan, K Disini, SPM KeDiPay, ... | Sub Tema | 0 | 0000 | ||
| 297 | Google Scholar | Authors : LO Nelwan, U Ahmad, R Hasbullah, IW Astika | Proceedings of AESAP 2016 The 1 st International Conference on the Role of Agricultural Engineering for Sustainable Agriculture Production | 0 | 0000 | ||
| 298 | Google Scholar | Authors : H Jantiko, IBK Suardana, KTP Gelgel | Quick jump to page content | 0 | 0000 | ||
| 299 | Google Scholar | Authors : IK Budaraga, Y Marlida, U Bulanin | Arnim.(2017). Chemical components analysis of Cinnamon liquid smoke with GC MS from various production of different purification method | International Journal of Chemical Technology Research 10 (1), 12-26 | 6 | 0000 | |
| 300 | Google Scholar | Authors : G Zulfitriyana, H Gusvita, IK Budaraga | Analysis Of Factors Affecting Demand Red Chili Pepper (Capsicum Annum L) In Solok And Effort Fulfillment | 0 | 0000 | ||
| 301 | Google Scholar | Authors : WS Devi | Pengabdian Kepada Masyarakat Penerapan Teori Kaizen untuk Meningkatan Kualitas Usaha Keripik Talas di UKM Asyifa Oleh-Oleh | SEMAR (Jurnal Ilmu Pengetahuan, Teknologi, dan Seni bagi Masyarakat) 12 (1 …, 0 | 1 | 0000 | |
| 302 | Google Scholar | Authors : IK Budaraga | Utilization Using Liquid Smoke Fish Fillet As Preservatives | 0 | 0000 | ||
| 303 | Google Scholar | Authors : IK Budaraga | BAB 4 ILMU SAGU | ILMU PANGAN JILID, 53, 0 | 0 | 0000 | |
| 304 | Google Scholar | Authors : RAGA SALIHAT, IK BUDARAGA, D SYUKRI, NR YANTI, EA FITRIA | The Effect of Addition of Wuluh Starfruit (Averrhoa bilimbi L.) Juice as a Coagulant in Cottage Cheese from Cow’s Milk | 0 | 0000 | ||
| 305 | Google Scholar | Authors : IK Budaraga, E Susanti | Study of Toxicity of Cacao Skin Liquid (Theobroma cacao, L) Using BSLT Method (Brine Shrimp Lethality Test) | 0 | 0000 | ||
| 306 | Google Scholar | Authors : B Indonesia | Unes Journal Mahasiswa Pertanian | 0 | 0000 | ||
| 307 | Google Scholar | Authors : M Sari | Yenti, and Asnurita I dan Ketut Budaraga Universitas Ekasakti. 2017 | Pengaruh Konsentrasi Starter Acetobacter Xylinum Terhadap Mutu Nata De …, 0 | 0 | 0000 | |
| 308 | Google Scholar | Authors : IK Budaraga, B Arnim, Yetti Marlida | Antioxidant Properties of Liquid Smoke Production Variation of Pyrolysis Temperature Raw and Different Concentration | International Journal of PharmTech Research 9 (6), 366-379, 0 | 17 | 0000 | |
| 309 | Google Scholar | Authors : IK Budaraga, YM Arnim | Usman Bulanin,. 2016. Liquid Smoke Toxicity Properties of Production of Raw Materials With Variation of Temperature and Concentration of Different | International Journal of PharmTech Research 9 (10) | 5 | 0000 | |
| 310 | Google Scholar | Authors : IK Budaraga | Kajian Mutu Pillet Lele Asap yang Diberikan Asap Cair Kayu Manis | 0 | 0000 | ||
| 311 | Google Scholar | Authors : RE Rachmanita, IK Budaraga, DE Rahmanto, MC Aprianto, S Pramudibyo, ... | TEKNOLOGI ENERGI TERBARUKAN | 0 | 0000 | ||
| 312 | Google Scholar | Authors : IK Budaraga, YM Arnim | Usman Bulanin,. 2016. Antioxidant Properties of Liquid Smoke Cinnamon Production of Variation Purification and Different Concentration | International Journal of Scientific & Technology Research (IJSTR). ISSN ISSN …, 0 | 5 | 0000 | |
| 313 | Scopus | Creator : Budaraga I.K. | Alginate addition from sargassum seaweed (Sargassum sp.) on pumpkin ice cream (cucurbita moschata durch.) characteristics | Annals of Agri Bio Research | 0 | Q4 as Journal | 2024 |
| 314 | Scopus | Creator : Budaraga I.K. | Study of liquid smoke toxicity cocoa shell with different purification methods | Iop Conference Series Earth and Environmental Science | 1 | Q3 as Conference Proceedin | 2024 |
| 315 | Scopus | Creator : Budaraga I.K. | Study of determination of benzoic acid, ascorbic acid in food using high performance liquid chromatography (HPLC) method | Aip Conference Proceedings | 0 | Q4 as Conference Proceedin | 2023 |
| 316 | Scopus | Creator : Salihat R.A. | The Effect of Addition of Wuluh Starfruit (Averrhoa bilimbi L.) Juice as a Coagulant in Cottage Cheese from Cow’s Milk | Annals of Agri Bio Research | 1 | Q4 as Journal | 2023 |
| 317 | Scopus | Creator : Budaraga I.K. | The study of the utilization of wuluh starfruit (Averrhoa bilimbi L.) in cottage cheese from goat milk prepared with acidification method based on physicochemical properties and organoleptic evaluation | Bulgarian Journal of Agricultural Science | 1 | Q3 as Journal | 2023 |
| 318 | Scopus | Creator : Budaraga I.K. | Acidification effects of starfruit (Averrhoa Bilimbi L.) on soy milk-based cottage cheese: A physicochemical and organoleptic assessment | Potravinarstvo Slovak Journal of Food Sciences | 1 | Q3 as Journal | 2023 |
| 319 | Scopus | Creator : Budaraga I.K. | The quality characteristics of biscuits made with plantain and purple rice flour as substitutes for wheat flour | Potravinarstvo Slovak Journal of Food Sciences | 2 | Q3 as Journal | 2023 |
| 320 | Scopus | Creator : Budaraga I.K. | Antioxidant Study of the Gambier Leaves By-Products into Tea with Red Ginger Powder Addition (Zingiber officinale Var. Rubrum) | Aip Conference Proceedings | 0 | Q4 as Conference Proceedin | 2023 |
| 321 | Scopus | Creator : Fitria E.A. | The effect of wuluh starfruit (Averrhoa bilimbi L.) added on the physicochemical and antimicrobial characteristics of chitosan-PVA edible film | Future of Food Journal on Food Agriculture and Society | 1 | Q3 as Journal | 2023 |
| 322 | Scopus | Creator : Budaraga I.K. | Characteristics of Maco Fish (Leiognathidae Spelendes) Using Coconut Shell Liquid Smoke as A Natural Preservative | Bio Web of Conferences | 0 | no-Q as Conference Proceedin | 2023 |
| 323 | Scopus | Creator : Ketut Budaraga I. | Heavy metals analysis (Cd, Pb, Zn, Cu, Cr) and calcium in Padang and Padang Panjang fresh cow's milk | Iop Conference Series Earth and Environmental Science | 3 | Q4 as Conference Proceedin | 2022 |
| 324 | Scopus | Creator : Budaraga I.K. | Microbial activities and minimum liquid smoke killing concentration made of cacao pod toward Lasiodiplodia theobromae growth | Iop Conference Series Earth and Environmental Science | 1 | Q4 as Conference Proceedin | 2022 |
| 325 | Scopus | Creator : Budaraga I.K. | The effect of material amount in distillation tank to chemical composition of citronella oil (Cymbopogon nardus L. Rendle) | Iop Conference Series Earth and Environmental Science | 1 | Q4 as Conference Proceedin | 2021 |
| 326 | Scopus | Creator : Ramaiyulis D.S. | Potential and development of incubation technology to improve the quality of "dadih" as a specific food of minangkabau | Livestock Research for Rural Development | 0 | Q3 as Journal | 2021 |
| 327 | Scopus | Creator : Ketut Budaraga I. | Analysis of metals (Pb, Mn, Cd, Zn, Cu) in Purple Rice and Purple Rice Stems Cultivated Organically using Biogas Slug in Padang Pariaman, West Sumatra Province | Iop Conference Series Earth and Environmental Science | 2 | Q4 as Conference Proceedin | 2021 |
| 328 | Scopus | Creator : Budaraga I.K. | Antibacterial study of cocoa skin liquid smoke in raw milk | Iop Conference Series Earth and Environmental Science | 3 | Q4 as Conference Proceedin | 2021 |
| 329 | Scopus | Creator : Budaraga I.K. | Quality of red tuna (Yellowfin tuna) fishball, white oyster mushroom (Pleurotus ostreatus) on different types of packaging and storage time | Iop Conference Series Earth and Environmental Science | 4 | Q4 as Conference Proceedin | 2021 |
| 330 | Scopus | Creator : Budaraga I.K. | Analysis antioxidant IC50 liquid smoke of cocoa skin with several purification methods | Iop Conference Series Earth and Environmental Science | 7 | Q4 as Conference Proceedin | 2021 |
| 331 | Scopus | Creator : Budaraga I.K. | Test liquid smoke toxicity for cocoa skin [Theobroma Cacao L.] with the BSLT method at different pyrolysis temperatures | Iop Conference Series Earth and Environmental Science | 1 | Q4 as Conference Proceedin | 2021 |
| 332 | Scopus | Creator : Budaraga I.K. | Antioxidant Activity of ‘Broken Skin’ Purple Rice, ‘Skinned’ Purple Rice, and Purple Rice Stem Organically Cultivated in Indonesia | International Journal on Advanced Science Engineering and Information Technology | 5 | Q2 as Journal | 2020 |
| 333 | Scopus | Creator : Budaraga I.K. | Study of Green Tea Catechin Dipped with Moringa Leaves | Iop Conference Series Earth and Environmental Science | 1 | Q4 as Conference Proceedin | 2020 |
| 334 | Scopus | Creator : Ketut Budaraga I. | Study of the physical properties of liquid smoke from cocoa rind on moisture content and different pyrolysis temperature | Iop Conference Series Earth and Environmental Science | 2 | Q4 as Conference Proceedin | 2020 |
| 335 | Scopus | Creator : Budaraga I.K. | Antioxidant Activity of ‘Broken Skin’ Purple Rice, ‘Skinned’ Purple Rice, and Purple Rice Stem Organically Cultivated in Indonesia | International Journal on Advanced Science Engineering and Information Technology | 5 | Q2 as Journal | 2020 |
| 336 | Scopus | Creator : Budaraga I.K. | Liquid Smoke Antimicrobial Test of Cocoa Fruit Peel Against Eschericia Coli and Staphylococcus Aureus Bacteria | Iop Conference Series Earth and Environmental Science | 7 | Q4 as Conference Proceedin | 2019 |
| 337 | Scopus | Creator : Ketut Budaraga I. | Influence of Liquid Smoke Cinnamon Against Attacks Leaf Rot Disease (Phytophthora Infestans) on Potato (Solanum Tuberosum L.) | Iop Conference Series Earth and Environmental Science | 2 | Q4 as Conference Proceedin | 2019 |
| 338 | Scopus | Creator : Budaraga I.K. | Study of chemical components of liquid smoke from cocoa rind in two variations of moisture content by using GC-MS method | Iop Conference Series Earth and Environmental Science | 0 | Q4 as Conference Proceedin | 2019 |
| 339 | Scopus | Creator : Ketut Budaraga I. | Liquid smoke toxicity properties of production of raw materials with variation of temperature and concentration of different | International Journal of Chemtech Research | 0 | no-Q as Journal | 2016 |
| 340 | Scopus | Creator : Budaraga K. | Liquid smoke production quality from raw materials variation and different pyrolysis temperature | International Journal on Advanced Science Engineering and Information Technology | 39 | Q4 as Journal | 2016 |
| 341 | Scopus | Creator : Ketut Budaraga I. | Analysis of liquid smoke chemical components with GC MS from different raw materials variation production and pyrolysis temperaturelevel | International Journal of Chemtech Research | 26 | no-Q as Journal | 2016 |
| 342 | Scopus | Creator : Ketut Budaraga I. | Antioxidant properties of liquid smoke production variation of pyrolysis temperature raw and different concentration | International Journal of Pharmtech Research | 3 | no-Q as Journal | 2016 |
| 343 | Garuda | I Ketut Budaraga; Eddwina Aidila Fitria | - Maize Nugget Making in Nagari Ladang Panjang, Pasaman Regency, West Sumatra: Pembuatan Nugget Jagung di Nagari Ladang Panjang, Kabupaten Pasaman, Sumatera Barat | Dinamisia : Jurnal Pengabdian Kepada Masyarakat Vol. 7 No. 4 (2023): Dinamisia: Jurnal Pengabdian Kepada Masyarakat1184-1189 | 3 | 2023 | |
| 344 | Garuda | I Ketut Budaraga; Eddwina Aidila Fitria | Pengabdian Kepada Masyarakat Penerapan Teori Kaizen untuk Meningkatan Kualitas Usaha Keripik Talas di UKM Asyifa Oleh-Oleh | Dinamisia : Jurnal Pengabdian Kepada Masyarakat Vol. 7 No. 4 (2023): Dinamisia: Jurnal Pengabdian Kepada Masyarakat1184-1189 | 3 | 2023 | |
| 345 | Garuda | I Ketut Budaraga; Eddwina Aidila Fitria | KAJIAN SIFAT FISIKOKIMIA DAN ORGANOLEPTIK SUSU SAPI MURNI DENGAN PENAMBAHAN ASAP CAIR SELAMA PENYIMPANAN | Dinamisia : Jurnal Pengabdian Kepada Masyarakat Vol. 7 No. 4 (2023): Dinamisia: Jurnal Pengabdian Kepada Masyarakat1184-1189 | 3 | 2023 | |
| 346 | Garuda | I Ketut Budaraga; Eddwina Aidila Fitria | Application of Chitosan Coating and Liquid Smoke as Antimicrobial Agent in Tuna Fish Pempek | Dinamisia : Jurnal Pengabdian Kepada Masyarakat Vol. 7 No. 4 (2023): Dinamisia: Jurnal Pengabdian Kepada Masyarakat1184-1189 | 3 | 2023 | |
| 347 | Garuda | I Ketut Budaraga; Eddwina Aidila Fitria | Pengujian Asam Lemak Bebas Pada Wajik Yang Dilapisi Edible Film Khitosan-PVA | Dinamisia : Jurnal Pengabdian Kepada Masyarakat Vol. 7 No. 4 (2023): Dinamisia: Jurnal Pengabdian Kepada Masyarakat1184-1189 | 3 | 2022 | |
| 348 | Garuda | I Ketut Budaraga; Eddwina Aidila Fitria | PENGABDIAN KEPADA MASYARAKAT PENINGKATAN KUALITAS PRODUKSI TAHU DI USAHA TAHU PAKDE IPONG | Dinamisia : Jurnal Pengabdian Kepada Masyarakat Vol. 7 No. 4 (2023): Dinamisia: Jurnal Pengabdian Kepada Masyarakat1184-1189 | 3 | 2022 | |
| 349 | Garuda | I Ketut Budaraga; Eddwina Aidila Fitria | PENGARUH PENAMBAHAN EKSTRAK GAMBIR (Uncaria gambir Roxb.) SEBAGAI ANTIBAKTERI PADA PEMBUATAN SABUN PADAT OPAQUE | Dinamisia : Jurnal Pengabdian Kepada Masyarakat Vol. 7 No. 4 (2023): Dinamisia: Jurnal Pengabdian Kepada Masyarakat1184-1189 | 3 | 2022 | |
| 350 | Garuda | I Ketut Budaraga; Eddwina Aidila Fitria | KAJIAN MUTU DAN AKTIVITAS ANTIOKSIDAN TEH KULIT KOPI (Coffea Canephora) DENGAN PENAMBAHAN DAUN MINT : Mentha Piperita L | Dinamisia : Jurnal Pengabdian Kepada Masyarakat Vol. 7 No. 4 (2023): Dinamisia: Jurnal Pengabdian Kepada Masyarakat1184-1189 | 3 | 2021 | |
| 351 | Garuda | I Ketut Budaraga; Eddwina Aidila Fitria | PENGARUH PENAMBAHAN SERBUK JAHE MERAH (Zingiber officinale Var. Rubrum) TERHADAP TEH HASIL KEMPAAN DAUN GAMBIR (Uncaria gambir Roxb) | Dinamisia : Jurnal Pengabdian Kepada Masyarakat Vol. 7 No. 4 (2023): Dinamisia: Jurnal Pengabdian Kepada Masyarakat1184-1189 | 3 | 2021 | |
| 352 | Garuda | I Ketut Budaraga; Eddwina Aidila Fitria | PENGARUH PENAMBAHAN SERBUK JAHE MERAH (Zingiber officinale Var. Rubrum) TERHADAP TEH HASIL KEMPAAN DAUN GAMBIR (Uncaria gambir Roxb) | Dinamisia : Jurnal Pengabdian Kepada Masyarakat Vol. 7 No. 4 (2023): Dinamisia: Jurnal Pengabdian Kepada Masyarakat1184-1189 | 3 | 2021 | |
| 353 | Garuda | Satri Wilanda; Nita Yessirita; I Ketut Budaraga | KAJIAN MUTU DAN AKTIVITAS ANTIOKSIDAN TEH KULIT KOPI (CoffeaCanephora) DENGAN PENAMBAHAN DAUN MINT (Mentha Piperita L) | Jurnal Research Ilmu Pertanian Vol. 1 No. 1 (2021): Jurnal Research Ilmu Pertanian (Februari 2021)76-83 | Accred : Unknown | 2021 | |
| 354 | Garuda | Satri Wilanda; Nita Yessirita; I Ketut Budaraga | Antibacterial Activity of Moringa Leaf Layer Cake Against S. aureus and E. coli | Jurnal Research Ilmu Pertanian Vol. 1 No. 1 (2021): Jurnal Research Ilmu Pertanian (Februari 2021)76-83 | Accred : Unknown | 2020 | |
| 355 | Garuda | Satri Wilanda; Nita Yessirita; I Ketut Budaraga | The Antioxidant Characteristics of The Liquid Smoke of Cocoa Shell ( Theobroma cacao, l ) In Different Water Content Variations | Jurnal Research Ilmu Pertanian Vol. 1 No. 1 (2021): Jurnal Research Ilmu Pertanian (Februari 2021)76-83 | Accred : Unknown | 2019 | |
| 356 | Garuda | Satri Wilanda; Nita Yessirita; I Ketut Budaraga | Penyuluhan Jajanan, Makanan dan Kantin Sehat di Sekolah SMA 2 Batang Anai Kecamatan Batang Anai Kabupaten Padang Pariaman | Jurnal Research Ilmu Pertanian Vol. 1 No. 1 (2021): Jurnal Research Ilmu Pertanian (Februari 2021)76-83 | Accred : Unknown | 2019 | |
| 357 | Garuda | Satri Wilanda; Nita Yessirita; I Ketut Budaraga | Pelatihan Pemanfaatan Limbah Kelapa (Lidi) Menjadi Kerajinan Tangan di Nagari IV Koto Mudik Kecamatan Batang Kapas Kabupaten Pesisir Selatan | Jurnal Research Ilmu Pertanian Vol. 1 No. 1 (2021): Jurnal Research Ilmu Pertanian (Februari 2021)76-83 | Accred : Unknown | 2019 | |
| 358 | Garuda | Satri Wilanda; Nita Yessirita; I Ketut Budaraga | PENGARUH KONSENTRASI STARTER Acetobacter xylinum TERHADAP MUTU NATA DE CUCUMBER | Jurnal Research Ilmu Pertanian Vol. 1 No. 1 (2021): Jurnal Research Ilmu Pertanian (Februari 2021)76-83 | Accred : Unknown | 2017 | |
| 359 | Garuda | Satri Wilanda; Nita Yessirita; I Ketut Budaraga | PENGARUH KONSENTRASI STARTER Acetobacter xylinum TERHADAP MUTU NATA DE CUCUMBER | Jurnal Research Ilmu Pertanian Vol. 1 No. 1 (2021): Jurnal Research Ilmu Pertanian (Februari 2021)76-83 | Accred : Unknown | 2017 | |
| 360 | Penelitian | Merry Thressia; I Ketut Budaraga | Studi Analisa Pembangkit Listrik Tenaga Hibrid PLTM Sako dan listrik PT.PLN(Persero) Rayo Balai Selasa Kabupaten Pesisir Selatan, Sumatera Barat |
Penelitian Kompetitif Nasional ( PFR ) Leader: Rosnita Rauf Sumber: BIMA SOURCE Status: Approved Dana: Rp104.310.000 |
2024 | ||
| 361 | Penelitian | Rera Aga Salihat; Eddwina Aidila Fitria | Pemanfaatan Belimbing Wuluh (Averrhoa bilimbi L.) dalam Pembuatan Keju Lunak (Soft Cheese) dengan Metode Asam |
Penelitian Kompetitif Nasional ( PDKN ) Leader: I Ketut Budaraga Sumber: BIMA SOURCE Status: Approved Dana: Rp145.430.000 |
2023 | ||
| 362 | Penelitian | Rera Aga Salihat; Eddwina Aidila Fitria | Pemanfaatan Belimbing Wuluh (Averrhoa bilimbi L.) dalam Pembuatan Keju Lunak (Soft Cheese) dengan Metode Asam |
Penelitian Kompetitif Nasional ( PDKN ) Leader: I Ketut Budaraga Sumber: BIMA SOURCE Status: Approved Dana: Rp138.100.000 |
2022 | ||
| 363 | Penelitian | - | Kajian Pemanfaatan Asap Cair dari Limbah Kulit Buah Coklat Sebagai Bahan Pengawet Susu Segar |
Penelitian Kompetitif Nasional ( PT ) Leader: I Ketut Budaraga Sumber: SIMLITABMAS SOURCE Status: Approved Dana: Rp156.673.070 |
2021 | ||
| 364 | Penelitian | - | Kajian Pemanfaatan Asap Cair dari Limbah Kulit Buah Coklat Sebagai Bahan Pengawet Susu Segar |
Penelitian Kompetitif Nasional ( PT ) Leader: I Ketut Budaraga Sumber: SIMLITABMAS SOURCE Status: Approved Dana: Rp163.341.570 |
2020 | ||
| 365 | Penelitian | I Ketut Budaraga; Ivonne Ayesha; Nofrita Sandi | Model dan Teknik Pengaturan suhu kelembaban otomatis pada kumbung Jamur Tiram menggunakan Digital Skylite. |
Penelitian Kompetitif Nasional ( PKPT ) Leader: Ananto Sumber: SIMLITABMAS SOURCE Status: Approved Dana: Rp63.555.000 |
2020 | ||
| 366 | Penelitian | - | Kajian Pemanfaatan Asap Cair dari Limbah Kulit Buah Coklat Sebagai Bahan Pengawet Susu Segar |
Penelitian Kompetitif Nasional ( PT ) Leader: I Ketut Budaraga Sumber: BIMA SOURCE Status: Approved Dana: Rp140.288.000 |
2019 | ||
| 367 | Penelitian | I Ketut Budaraga; Ivonne Ayesha; Nofrita Sandi | Model dan Teknik Pengaturan suhu kelembaban otomatis pada kumbung Jamur Tiram menggunakan Digital Skylite. |
Penelitian Kompetitif Nasional ( PKPT ) Leader: Ananto Sumber: SIMLITABMAS SOURCE Status: Approved Dana: Rp65.155.000 |
2019 | ||
| 368 | Penelitian | Gusriati | Kajian Mutu Fillet Lele Asap yang Diberikan Asap Cair Kayu Manis |
Penelitian Kompetitif Nasional ( PPT/Produk Terapan ) Leader: I Ketut Budaraga Sumber: BIMA SOURCE Status: Approved Dana: Rp50.000.000 |
2013 | ||
| 369 | Pengabdian | Fridarti | PENERAPAN PERTANIANTERINTEGRASI UNTUK PENINGKATAN PENDAPATAN PETANI DALAM RANGKA MEWUJUDKAN KETAHANAN PANGAN DI NAGARI KASANG KECAMATAN BATANG ANAI KABUPATEN PADANG PARIAMAN |
Pengabdian Kepada Masyarakat Kompetitif Nasional ( KKN-PPM ) Leader: I Ketut Budaraga Sumber: SIMLITABMAS SOURCE Status: Approved Dana: Rp62.500.000 |
2016 | ||
| 370 | Pengabdian | Yurnalis | IbM KELOMPOK TANI TEBU SIRANGKAK GADANG DAN SARUNAI MAIMBAU |
Pengabdian Kepada Masyarakat Kompetitif Nasional ( PKM ) Leader: I Ketut Budaraga Sumber: BIMA SOURCE Status: Approved Dana: Rp42.500.000 |
2015 | ||
| 371 | Pengabdian | Prima Novia | IbM KELOMPOK ORGANISASI PADAT KARYA 4 SAJAREK |
Pengabdian Kepada Masyarakat Kompetitif Nasional ( PKM ) Leader: I Ketut Budaraga Sumber: SIMLITABMAS SOURCE Status: Approved Dana: Rp48.000.000 |
2014 | ||
| 372 | Pengabdian | I Ketut Budaraga | PENINGKATAN PENDAPATAN MASYARAKAT MELALUI PEMANFAATAN BRIKET TEMPURUNG KELAPA,KOMPOR BRIKET DAN ASAP CAIR DI DESA SUNGAI RAMBAI KECAMATAN PARIAMAN UTARA KOTA PARIAMAN PROVINSI SUMATERA BARAT |
Pengabdian Kepada Masyarakat Kompetitif Nasional ( KKN-PPM ) Leader: Risal Abu Sumber: SIMLITABMAS SOURCE Status: Approved Dana: Rp60.000.000 |
2014 | ||
| 373 | Pengabdian | I Ketut Budaraga | PENINGKATAN PRODUKSI TANAMAN KAKAO MELALAUI PEMANFAATAN ASAP CAIR TEMPURUNG KELAPA DAN PUPUK ORGANIK DI NAGARI SUNGAI BULUH KECAMATAN BATANG ANAI KABUPATEN PADANG PARIAMAN PROVINSI SUMATERA BARAT |
Pengabdian Kepada Masyarakat Kompetitif Nasional ( KKN-PPM ) Leader: Gusriati Sumber: BIMA SOURCE Status: Approved Dana: Rp60.000.000 |
2013 | ||
| 374 | Pengabdian | - | Kelompok Tani Tagamang Bajawek di Padang Pariaman Sumbar |
Pengabdian Kepada Masyarakat Kompetitif Nasional ( PKM ) Leader: I Ketut Budaraga Sumber: BIMA SOURCE Status: Approved Dana: Rp45.000.000 |
2013 | ||
| 375 | Buku | Nurhayati, I Ketut Budaraga, Nurul Fajrih H., Soraya Kusuma Putri, Juni Sumarmono, Rahmaniar, Rifda Naufalin, Santi Dwi Astuti, Sri Widowati | Ilmu Pangan (Jilid 2) | CV HEI Publishing | 2024 | ||
| 376 | Buku | Nurhayati, I Ketut Budaraga, Nurul Fajrih H., Soraya Kusuma Putri, Juni Sumarmono, Rahmaniar, Rifda Naufalin, Santi Dwi Astuti, Sri Widowati | Teknologi Energi Terbarukan | CV HEI Publishing | 2024 | ||
| 377 | Buku | Nurhayati, I Ketut Budaraga, Nurul Fajrih H., Soraya Kusuma Putri, Juni Sumarmono, Rahmaniar, Rifda Naufalin, Santi Dwi Astuti, Sri Widowati | TEKNIK EVALUASI SENSORI PRODUK PANGAN | CV HEI Publishing | 2024 | ||
| 378 | Buku | Nurhayati, I Ketut Budaraga, Nurul Fajrih H., Soraya Kusuma Putri, Juni Sumarmono, Rahmaniar, Rifda Naufalin, Santi Dwi Astuti, Sri Widowati | PERANAN TEKNOLOGI PENGOLAHAN DAN PENGAWETAN PANGAN BERBASIS SUMBER DAYA DAN KEARIFAN LOKAL UNTUK MEWUJUDKAN PANGAN SEHAT | CV HEI Publishing | 2024 | ||
| 379 | Buku | Nurhayati, I Ketut Budaraga, Nurul Fajrih H., Soraya Kusuma Putri, Juni Sumarmono, Rahmaniar, Rifda Naufalin, Santi Dwi Astuti, Sri Widowati | Fisiologi Pascapanen | CV HEI Publishing | 2024 | ||
| 380 | Buku | Nurhayati, I Ketut Budaraga, Nurul Fajrih H., Soraya Kusuma Putri, Juni Sumarmono, Rahmaniar, Rifda Naufalin, Santi Dwi Astuti, Sri Widowati | Teknologi Tepat Guna dan Teknologi Terapan | CV HEI Publishing | 2024 | ||
| 381 | Buku | Nurhayati, I Ketut Budaraga, Nurul Fajrih H., Soraya Kusuma Putri, Juni Sumarmono, Rahmaniar, Rifda Naufalin, Santi Dwi Astuti, Sri Widowati | Konsep Pemberdayaan Masyarakat | CV HEI Publishing | 2024 | ||
| 382 | Buku | Nurhayati, I Ketut Budaraga, Nurul Fajrih H., Soraya Kusuma Putri, Juni Sumarmono, Rahmaniar, Rifda Naufalin, Santi Dwi Astuti, Sri Widowati | Keamanan Pangan | CV HEI Publishing | 2024 | ||
| 383 | Buku | Nurhayati, I Ketut Budaraga, Nurul Fajrih H., Soraya Kusuma Putri, Juni Sumarmono, Rahmaniar, Rifda Naufalin, Santi Dwi Astuti, Sri Widowati | Ilmu Pangan Jilid 1 | CV HEI Publishing | 2024 | ||
| 384 | Buku | Nurhayati, I Ketut Budaraga, Nurul Fajrih H., Soraya Kusuma Putri, Juni Sumarmono, Rahmaniar, Rifda Naufalin, Santi Dwi Astuti, Sri Widowati | TEKNOLOGI PENGOLAHAN KELAPA TERPADU BESERTA BERBAGAI TUTORIAL PENGOLAHAN POHON KELAPA | CV HEI Publishing | 2024 | ||
| 385 | Buku | Muhammad Iqbal Fanani Gunawan, Andini Putri Riandani, Erna Rusliana Muhamad Saleh, Indah Rodianawati, I Ketut Budaraga, Sri Surani, Syarifa Ramadhani Nurbaya, Santi Dwi Astuti, Nurhayati, Zalfadhiyaa Naufal Fayyadh | TEKNIK EVALUASI SENSORI PRODUK PANGAN | Hei Publishing | 2024 | ||
| 386 | Buku | Muhammad Iqbal Fanani Gunawan, Andini Putri Riandani, Erna Rusliana Muhamad Saleh, Indah Rodianawati, I Ketut Budaraga, Sri Surani, Syarifa Ramadhani Nurbaya, Santi Dwi Astuti, Nurhayati, Zalfadhiyaa Naufal Fayyadh | Fisiologi Pascapanen | Hei Publishing | 2024 | ||
| 387 | Buku | Muhammad Iqbal Fanani Gunawan, Andini Putri Riandani, Erna Rusliana Muhamad Saleh, Indah Rodianawati, I Ketut Budaraga, Sri Surani, Syarifa Ramadhani Nurbaya, Santi Dwi Astuti, Nurhayati, Zalfadhiyaa Naufal Fayyadh | PERANAN TEKNOLOGI PENGOLAHAN DAN PENGAWETAN PANGAN BERBASIS SUMBER DAYA DAN KEARIFAN LOKAL UNTUK MEWUJUDKAN PANGAN SEHAT | Hei Publishing | 2024 | ||
| 388 | Buku | Muhammad Iqbal Fanani Gunawan, Andini Putri Riandani, Erna Rusliana Muhamad Saleh, Indah Rodianawati, I Ketut Budaraga, Sri Surani, Syarifa Ramadhani Nurbaya, Santi Dwi Astuti, Nurhayati, Zalfadhiyaa Naufal Fayyadh | Teknologi Tepat Guna dan Teknologi Terapan | Hei Publishing | 2024 | ||
| 389 | Buku | Muhammad Iqbal Fanani Gunawan, Andini Putri Riandani, Erna Rusliana Muhamad Saleh, Indah Rodianawati, I Ketut Budaraga, Sri Surani, Syarifa Ramadhani Nurbaya, Santi Dwi Astuti, Nurhayati, Zalfadhiyaa Naufal Fayyadh | Konsep Pemberdayaan Masyarakat | Hei Publishing | 2024 | ||
| 390 | Buku | Muhammad Iqbal Fanani Gunawan, Andini Putri Riandani, Erna Rusliana Muhamad Saleh, Indah Rodianawati, I Ketut Budaraga, Sri Surani, Syarifa Ramadhani Nurbaya, Santi Dwi Astuti, Nurhayati, Zalfadhiyaa Naufal Fayyadh | Keamanan Pangan | Hei Publishing | 2024 | ||
| 391 | Buku | Muhammad Iqbal Fanani Gunawan, Andini Putri Riandani, Erna Rusliana Muhamad Saleh, Indah Rodianawati, I Ketut Budaraga, Sri Surani, Syarifa Ramadhani Nurbaya, Santi Dwi Astuti, Nurhayati, Zalfadhiyaa Naufal Fayyadh | Teknologi Pengolahan Hasil Perkebunan | Hei Publishing | 2024 | ||
| 392 | Buku | Muhammad Iqbal Fanani Gunawan, Andini Putri Riandani, Erna Rusliana Muhamad Saleh, Indah Rodianawati, I Ketut Budaraga, Sri Surani, Syarifa Ramadhani Nurbaya, Santi Dwi Astuti, Nurhayati, Zalfadhiyaa Naufal Fayyadh | Ketahanan Pangan dan Kearifan Lokal | Hei Publishing | 2024 | ||
| 393 | Buku | Muhammad Iqbal Fanani Gunawan, Andini Putri Riandani, Erna Rusliana Muhamad Saleh, Indah Rodianawati, I Ketut Budaraga, Sri Surani, Syarifa Ramadhani Nurbaya, Santi Dwi Astuti, Nurhayati, Zalfadhiyaa Naufal Fayyadh | Pertanian terpadu organik sistem sabicaitala mendukung ekonomi berkelanjutan | Hei Publishing | 2024 | ||
| 394 | Buku | Muhammad Iqbal Fanani Gunawan, Andini Putri Riandani, Erna Rusliana Muhamad Saleh, Indah Rodianawati, I Ketut Budaraga, Sri Surani, Syarifa Ramadhani Nurbaya, Santi Dwi Astuti, Nurhayati, Zalfadhiyaa Naufal Fayyadh | Pertanian organik penyelamat kehidupan | Hei Publishing | 2024 | ||
| 395 | Buku | penulis, I Ketut Budaraga ; editor, Dendi Kurniawan | Buku manual cara membuat asap cair dari kulit buah kakao dan aplikasi sebagai pestisida tanaman kakao | Lembaga Penelitian dan Pengabdian Kepada Masyaraka | 2019 | ||
| 396 | Buku | penulis, I Ketut Budaraga ; editor, Dendi Kurniawan | Liquid Smoke Toxicity With Variation Of Temperature And Concentration | Lembaga Penelitian dan Pengabdian Kepada Masyaraka | 2019 | ||
| 397 | Scopus | Creator : Budaraga I.K. | Characteristics of the liquid chemical properties of cocoa skin [Theobroma cacao L.] in different water levels | Iop Conference Series Earth and Environmental Science | 2 | Q4 as Conference Proceedin | 2020 |
| 398 | Google Scholar | Authors : IK Budaraga | Telur Sebagai Bahan Pangan | Hei Publishing Indonesia, 2024 | 0 | 2024 | |
| 399 | Google Scholar | Authors : MPWPRUBIKBTKHSMRHCYSADPG Setiavani | Buku Teknologi Pengolahan Hasil Perkebunan | IN Patent EC00,202,444,712, 2024 | 0 | 2024 | |
| 400 | Google Scholar | Authors : HTPSKDYHAFAPBEMITQAAFESIK Budaraga | Buku Konsep Pemberdayaan Masyarakat | IN Patent EC00,202,449,833, 2024 | 0 | 2024 | |
| 401 | Google Scholar | Authors : IK Budaraga | Telur Sebagai Bahan Pangan | Hei Publishing Indonesia, 2024 | 0 | 2024 | |
| 402 | Google Scholar | Authors : IK Budaraga, A Asnurita, Y Novera | The quality characteristics of biscuits made with plantain and purple rice flour as substitutes for wheat flour | Potravinarstvo Slovak Journal of Food Sciences 17, 69-81, 2023 | 1 | 2023 | |
| 403 | Google Scholar | Authors : IK Budaraga, EA Fitria | -Maize Nugget Making in Nagari Ladang Panjang, Pasaman Regency, West Sumatra: Pembuatan Nugget Jagung di Nagari Ladang Panjang, Kabupaten Pasaman, Sumatera Barat | Dinamisia: Jurnal Pengabdian Kepada Masyarakat 7 (4), 1184-1189, 2023 | 1 | 2023 | |
| 404 | Google Scholar | Authors : IK Budaraga, A Asnurita, Y Novera | The quality characteristics of biscuits made with plantain and purple rice flour as substitutes for wheat flour | Potravinarstvo Slovak Journal of Food Sciences 17, 69-81, 2023 | 1 | 2023 | |
| 405 | Google Scholar | Authors : AP Kamaruddin, E Sutrisno, S Akhmaddhian, E Wisdawati, SI Tito, ... | Ketahanan Pangan dan Kearifan Lokal | 0 | 2023 | ||
| 406 | Google Scholar | Authors : IK Budaraga, RA Salihat, EA Fitria | The study of the utilization of wuluh starfruit (Averrhoa bilimbi L.) in cottage cheese from goat milk prepared with acidification method based on physicochemical properties … | Bulgarian Journal of Agricultural Science 29 (5), 873-881, 2023 | 4 | 2023 | |
| 407 | Google Scholar | Authors : T Astina, A Asnurita, IK Budaraga | Pengaruh Penambahan Ekstrak Gambir (Uncaria Gambir Roxb.) Sebagai Antibakteri Pada Pembuatan Sabun Padat Buram | Jurnal Teknologi Pertanian Andalas 26 (2), 142-150, 2022 | 0 | 2022 | |
| 408 | Google Scholar | Authors : W Budaraga I Ketut | Pengabdian kepada Masyarakat Peningkatan Kualitas Usaha Keripik Talas Asyifa Oleh-oleh | Seminar Nasional Pengabdian Fakultas Pertanian UNS Tahun 2021 1 (1), 172-180, 2022 | 0 | 2022 | |
| 409 | Google Scholar | Authors : W Budaraga I Ketut | Pengabdian kepada Masyarakat Peningkatan Kualitas Usaha Keripik Talas Asyifa Oleh-oleh | Seminar Nasional Pengabdian Fakultas Pertanian UNS Tahun 2021 1 (1), 172-180, 2022 | 0 | 2022 | |
| 410 | Google Scholar | Authors : T Astina, A Asnurita, IK Budaraga | Pengaruh Penambahan Ekstrak Gambir (Uncaria Gambir Roxb.) Sebagai Antibakteri Pada Pembuatan Sabun Padat Buram | Jurnal Teknologi Pertanian Andalas 26 (2), 142-150, 2022 | 0 | 2022 | |
| 411 | Google Scholar | Authors : IK Budaraga, RA Salihat | Antioxidant Activity of ‘Broken Skin’ Purple Rice, ‘Skinned’ Purple Rice, and Purple Rice Stem Organically Cultivated in Indonesia | International Journal on Advanced Science, Engineering and Information …, 2020 | 7 | 2020 | |
| 412 | Google Scholar | Authors : IK Budaraga, R Ramaiyulis, E Susanti, A Asnurita, E Nurdin | The antioxidant characteristics of the liquid smoke of cocoa shell (Theobroma cacao, L) in different water content variations | Journal of Applied Agricultural Science and Technology 3 (2), 226-238, 2019 | 9 | 2019 | |
| 413 | Google Scholar | Authors : IK Budaraga | Karakteristik Asap Cair Kulit Kakao (Theobroma Cacao, l) Pada Air Yang Berbeda | UNES JOURNAL MAHASISWA PERTANIAN 3 (1), 011-019, 2019 | 0 | 2019 | |
| 414 | Google Scholar | Authors : A Ananto | Models and Techniques of Automatic Humidity Temperature setting on Oyster Mushrooms using Digital Skylite | International Journal of ChemTech Research 12 (6), 71-75, 2019 | 0 | 2019 | |
| 415 | Google Scholar | Authors : IK Budaraga | Disertasi:Potensi Asap Cair Dari Berbagai Sumber Dan Aplikasinya Sebagai Pengawet Fillet Ikan Nila (Oreochromis Nilotica) | 0 | 2018 | ||
| 416 | Google Scholar | Authors : IK Budaraga | MEMBANGUN PRODUKSI PADI ORGANIK: KENDALA TEKNIS, EKONOMIS DAN SOSIAL | UNES JOURNAL OF AGRICULTURAL SCIENTIES 1 (2), 167-175, 2017 | 0 | 2017 | |
| 417 | Google Scholar | Authors : IK Budaraga | MEMBANGUN PRODUKSI PADI ORGANIK: KENDALA TEKNIS, EKONOMIS DAN SOSIAL | UNES JOURNAL OF AGRICULTURAL SCIENTIES 1 (2), 167-175, 2017 | 0 | 2017 | |
| 418 | Google Scholar | Authors : S Syamsuwirman, IK Budaraga, T Tukiran | PENGARUH PENGGUNAAN ASAP CAIR TERHADAP SERANGAN PENYAKIT BUSUK DAUN (Phytophthora infestans) PADA KENTANG (Solanum tuberasum L.) | UNES Journal of Scientech Research 2 (2), 218-228, 2017 | 0 | 2017 | |
| 419 | Google Scholar | Authors : IK Budaraga | Effect of Combination Treatment of Concentration Liquid Smoke, Immersion Duration, Packaging and Long Storage different Levels of Antioxidant Tilapia Fish Fillet (... | International Journal of ChemTech Research 10 (nomor 15), 332-343 | 1 | 2017 | |
| 420 | Google Scholar | Authors : IK Budaraga | Antibacterial Properties of Liquid Smoke from Various Raw Materials with Different Pyrolysis Temperature Level | International Journal of ChemTech Research 10 (5), 31-45, 2017 | 1 | 2017 | |
| 421 | Google Scholar | Authors : IK Budaraga | Effect of Combination Treatment of Concentration Liquid Smoke, Immersion Duration, Packaging and Long Storage different Levels of Antioxidant Tilapia Fish Fillet (... | International Journal of ChemTech Research 10 (nomor 15), 332-343 | 1 | 2017 | |
| 422 | Google Scholar | Authors : IK Budaraga | Effect of Combination Treatment of Concentration Liquid Smoke, Immersion Duration, Packaging and Long Storage different Levels of Antioxidant Tilapia Fish Fillet (... | International Journal of ChemTech Research 10 (nomor 15), 332-343 | 1 | 2017 | |
| 423 | Google Scholar | Authors : IK Budaraga, A Arnim, Y Marlinda, U Bulain | Characteristics of cinnamon liquid smoke produced using several purification techniques | American Journal of Food Science and Nutrition Research 3 (2), 16-21, 2016 | 11 | 2016 | |
| 424 | Google Scholar | Authors : IK Budaraga, A Arnim, Y Marlinda, U Bulain | Analysis of liquid smoke chemical components with GC MS from different raw materials variation production and pyrolysis temperature level | International Journal of ChemTech Research 9 (06), 694-708, 2016 | 45 | 2016 | |
| 425 | Google Scholar | Authors : Z I Ketut Budaraga,Fridarti, Salamanang | Pembuatan Pakan Ternak Sapi dari Jerami menggunakan Ramuan Organik Ternak (ROTER) sebagai salah satu perwujudan kegiatan KKN-PPM Pertanian Terintegrasi di Kanagarian Kasang Kecamatan Batang Anai Kabupaten Padang Pariaman | Politeknik Pertanian Negeri Pertanian Payakumbuh 1, 177-198 | 0 | 2016 | |
| 426 | Google Scholar | Authors : IK Budaraga, F Fridarti | Biogas Technology Application As One Of The Realization Of Kkn Ppm Integrated In Agricultural District Kanagarian kasang Batang Anai Padang Pariaman | 0 | 2016 | ||
| 427 | Google Scholar | Authors : B I Ketut, F Fridarti | Pembuatan Pakan Ternak Sapi dari Jerami menggunakan Ramuan Organik Ternak (ROTER) sebagai salah satu perwujudan Kegiatan KKN-PPM Terintegrasi di kanagarian Kasang kecamatan … | Seminar Nasional Politekni Pertanian Negeri Payakumbuh 1 (1), 177-isi, 2016 | 0 | 2016 | |
| 428 | Google Scholar | Authors : IK Budaraga, A Arnim, Y Marlida, U Bulanin | Liquid smoke toxicity characteristic from raw materials variation production with different temperature and concentration level. | 0 | 2016 | ||
| 429 | Google Scholar | Authors : IK Budaraga | Effect Combination Treatment Different Concentration of Liquid Smoke, Immersion Duration, Packaging and Storage Duration to Organoleptic quality Fillet Tilapia Fi... | 0 | 2016 | ||
| 430 | Google Scholar | Authors : IK Budaraga, A Arnim, Y Marlinda, U Bulain | Toxicity of liquid smoke cinnamon (Cinnamomum Burmannii) production of ways for purification and different concentration | Journal of Scientific and Research Publication 6 (7), 13-21, 2016 | 18 | 2016 | |
| 431 | Google Scholar | Authors : Z I Ketut Budaraga,Fridarti, Salamanang | Pembuatan Pakan Ternak Sapi dari Jerami menggunakan Ramuan Organik Ternak (ROTER) sebagai salah satu perwujudan kegiatan KKN-PPM Pertanian Terintegrasi di Kanagarian Kasang Kecamatan Batang Anai Kabupaten Padang Pariaman | Politeknik Pertanian Negeri Pertanian Payakumbuh 1, 177-198 | 0 | 2016 | |
| 432 | Google Scholar | Authors : IK Budaraga, F Fridarti | Biogas Technology Application As One Of The Realization Of Kkn Ppm Integrated In Agricultural District Kanagarian kasang Batang Anai Padang Pariaman | 0 | 2016 | ||
| 433 | Google Scholar | Authors : IK Budaraga | Effect Combination Treatment Different Concentration of Liquid Smoke, Immersion Duration, Packaging and Storage Duration to Organoleptic quality Fillet Tilapia Fi... | 0 | 2016 | ||
| 434 | Google Scholar | Authors : IK Budaraga, A Arnim, Y Marlinda, U Bulain | Toxicity of liquid smoke cinnamon (Cinnamomum Burmannii) production of ways for purification and different concentration | Journal of Scientific and Research Publication 6 (7), 13-21, 2016 | 18 | 2016 | |
| 435 | Google Scholar | Authors : IK Budaraga, A Arnim, Y Marlinda, U Bulain | Analysis of liquid smoke chemical components with GC MS from different raw materials variation production and pyrolysis temperature level | International Journal of ChemTech Research 9 (06), 694-708, 2016 | 45 | 2016 | |
| 436 | Google Scholar | Authors : Z I Ketut Budaraga,Fridarti, Salamanang | Pembuatan Pakan Ternak Sapi dari Jerami menggunakan Ramuan Organik Ternak (ROTER) sebagai salah satu perwujudan kegiatan KKN-PPM Pertanian Terintegrasi di Kanagarian Kasang … | Politeknik Pertanian Negeri Pertanian Payakumbuh 1, 177-198 | 0 | 2016 | |
| 437 | Google Scholar | Authors : IK Budaraga, A Arnim, Y Marlida, U Bulanin | Liquid smoke toxicity characteristic from raw materials variation production with different temperature and concentration level. | 0 | 2016 | ||
| 438 | Google Scholar | Authors : Z I Ketut Budaraga,Fridarti, Salamanang | Pembuatan Pakan Ternak Sapi dari Jerami menggunakan Ramuan Organik Ternak (ROTER) sebagai salah satu perwujudan kegiatan KKN-PPM Pertanian Terintegrasi di Kanagarian Kasang Kecamatan Batang Anai Kabupaten Padang Pariaman | Politeknik Pertanian Negeri Pertanian Payakumbuh 1, 177-198 | 0 | 2016 | |
| 439 | Google Scholar | Authors : IK Budaraga, F Fridarti | Biogas Technology Application As One Of The Realization Of Kkn Ppm Integrated In Agricultural District Kanagarian kasang Batang Anai Padang Pariaman | 0 | 2016 | ||
| 440 | Google Scholar | Authors : B I Ketut, F Fridarti | Pembuatan Pakan Ternak Sapi dari Jerami menggunakan Ramuan Organik Ternak (ROTER) sebagai salah satu perwujudan Kegiatan KKN-PPM Terintegrasi di kanagarian Kasang kecamatan … | Seminar Nasional Politekni Pertanian Negeri Payakumbuh 1 (1), 177-isi, 2016 | 0 | 2016 | |
| 441 | Google Scholar | Authors : IK Budaraga, P Novia | Ibm Kelompok Organisasi Padat Karya 4 Sajarek | Jurnal Penelitian dan Kajian Ilmiah Menara Ilmu 8 (51), 34-38, 2014 | 0 | 2014 | |
| 442 | Google Scholar | Authors : IKB dan gusriati | Kajian efek antioksidan asap cair kayu manis untuk menghambat oksidasi lemak pada filet ikan nila (oriochromis nilotica) asap selama penyimpanan pada suhu ka... | Ekotrans 214 (Volume.12 No. 1 Januari 2012), 191-214 | 0 | 2012 | |
| 443 | Google Scholar | Authors : IKB dan gusriati | Kajian efek antioksidan asap cair kayu manis untuk menghambat oksidasi lemak pada filet ikan nila (oriochromis nilotica) asap selama penyimpanan pada suhu kamar | Ekotrans 214 (Volume.12 No. 1 Januari 2012), 191-214, 2012 | 0 | 2012 | |
| 444 | Google Scholar | Authors : IK Budaraga | Pengenalan Sistem Pertanian Organik kepada Masyarakat | Ekasakti 125 (Vol 21.N0.2 Agustus 2011 ISSN 0854-8099), 1-14, 2011 | 0 | 2011 | |
| 445 | Google Scholar | Authors : UB I Ketut Budaraga, Arnim, Yetti Marlida | Uji Kinerja Alat dan Identifikasi Produk AsaCair Kayu Manis Pada Berbagai Waktu Pirolisis dan Cara Pemurnian Untuk Pengawet Filet Ikan Nila | Ekasakti 20 (1), 137-165, 2011 | 0 | 2011 | |
| 446 | Google Scholar | Authors : IK Budaraga | Pengenalan Sistem Pertanian Organik kepada Masyarakat | Ekasakti 125 (Vol 21.N0.2 Agustus 2011 ISSN 0854-8099), 1-14, 2011 | 0 | 2011 | |
| 447 | Google Scholar | Authors : UB I Ketut Budaraga, Arnim, Yetti Marlida | Uji Kinerja Alat dan Identifikasi Produk AsaCair Kayu Manis Pada Berbagai Waktu Pirolisis dan Cara Pemurnian Untuk Pengawet Filet Ikan Nila | Ekasakti 20 (1), 137-165, 2011 | 0 | 2011 | |
| 448 | Google Scholar | Authors : IK Budaraga | Pengolahan Limbah Tapioka Menjadi Biogas (Energi Alternatif) | Jurnal Ekotrans Jurnal Pemikiran dan Analisis masalah Ekologi dan …, 2009 | 0 | 2009 | |
| 449 | Google Scholar | Authors : IMP Bungsu, IK Budaraga, N Yessirita | JURNAL RESEARCH ILMU PERTANIAN (JRIP) | 0 | 0000 | ||
| 450 | Google Scholar | Authors : IK Budaraga, RA Salihat, EA Fitria | Teknologi Dan Karakteristik Keju Lunak: Produksi, Mutu, Dan Inovasi | Hei Publishing, 2025 | 0 | 2025 | |
| 451 | Google Scholar | Authors : IK Budaraga | Keamanan Pangan dan Nutrisi | CVLauk Puyu Press, 2025 | 0 | 2025 | |
| 452 | Google Scholar | Authors : IK Budaraga | Sifat Fungsional Asam LEmak Trans | Hei Publishing Indonesia, 2024 | 0 | 2024 | |
| 453 | Google Scholar | Authors : S I Ketut Budaraga1,*, Eddwina Aidila Fitria1 | Identification of Salmonella SP on Food Preparations (Seasoning and Rakik Chips) in Padang City | Proceeding 2nd International Conference Khairun University (IConKU) 2024 1 …, 2024 | 0 | 2024 | |
| 454 | Google Scholar | Authors : MIF Gunawan, AP Riandani, ERM Saleh, I Rodianawati, IK Budaraga, ... | Teknik Evaluasi Sensori Produk Pangan | 2 | 2024 | ||
| 455 | Google Scholar | Authors : IK Budaraga | Peranan Teknologi Pengolahan Dan Pengawetan Pangan Berbasis Sumber Daya Dan Kearifan Lokal Untuk Mewujudkan Pangan Sehat | Hei Publishing Indonesia, 2024 | 0 | 2024 | |
| 456 | Google Scholar | Authors : IK Budaraga, L Hermalena, I Ahsan | Characteristics of Maco Fish (Leiognathidae Spelendes) Using Coconut Shell Liquid Smoke as A Natural Preservative | BIO Web of Conferences 69, 03003, 2023 | 0 | 2023 | |
| 457 | Google Scholar | Authors : IK Budaraga, L Hermalena, I Ahsan | Characteristics of Maco Fish (Leiognathidae Spelendes) Using Coconut Shell Liquid Smoke as A Natural Preservative | BIO Web of Conferences 69, 03003, 2023 | 0 | 2023 | |
| 458 | Google Scholar | Authors : IK Budaraga | Influence of liquid smoke cinnamon against attacks leaf rot disease (Phytophthora Infestans) on potato (Solanum Tuberosum L.) | IOP Conference Series: Earth and Environmental Science 347 (1), 012036, 2019 | 4 | 2019 | |
| 459 | Google Scholar | Authors : IK Budaraga | Influence of liquid smoke cinnamon against attacks leaf rot disease (Phytophthora Infestans) on potato (Solanum Tuberosum L.) | IOP Conference Series: Earth and Environmental Science 347 (1), 012036, 2019 | 4 | 2019 | |
| 460 | Google Scholar | Authors : IK Budaraga | Liquid Smoke Toxicity With Variation Of Temperature And Concentration | 0 | 2018 | ||
| 461 | Google Scholar | Authors : IK Budaraga | Kajian Aktivitas Antioksidan, Tannin dan Kadar Air Teh Hijau Celup Akibat Penambahan Bubuk Jahe Merah (Zingiber officinale Rosc) | UNES Journal of Agricultural Scienties 2 (1), 041-052, 2018 | 2 | 2018 | |
| 462 | Google Scholar | Authors : IK Budaraga | Liquid Smoke Toxicity With Variation Of Temperature And Concentration | 0 | 2018 | ||
| 463 | Google Scholar | Authors : IK Budaraga | Effect of Combination Treatment of Concentration Liquid Smoke, Immertion Duration, Packaging and old Type Storage different Levels of Protein Nila Fish Fillet (Oreochromis … | Journal of ChemTech Research 10 (3), 1-10, 2017 | 5 | 2017 | |
| 464 | Google Scholar | Authors : G Gusriati, A Armia, IK Budaraga | MEMBANGUN PRODUKSI PADI ORGANIK: KENDALA TEKNIS, EKONOMIS DAN SOSIAL (Studi Kasus pada Petani Organic di Nagari Sariek Alahan Tigo Kecamatan Hiliran Gumanti Kabupaten Solok) | Unes Journal of Agricultural Scienties 1 (2), 167-175 | 0 | 2017 | |
| 465 | Google Scholar | Authors : IK Budaraga | Effect of Combination Treatment of Liquid Smoke Concentration, Soaking Time, Packaging and Different Storage Time To Yield And Moisture Content nila Fish Fillet (Oreochromis … | International Journal of ChemTech Research 10 (1), 77-88, 2017 | 1 | 2017 | |
| 466 | Google Scholar | Authors : IK Budaraga, A Arnim, Y Marlinda, U Bulain | Chemical Components Analysis of Cinnamon Liquid Smoke with GC MS from Various Production of different Purification Method | International Journal of ChemTech Research 10 (1), 12-26, 2017 | 10 | 2017 | |
| 467 | Google Scholar | Authors : IK Budaraga | Effect of Combination Treatment of Concentration Liquid Smoke, Immersion Duration, Packaging and Long Storage different Levels of Antibacterials Nila Fish Fillet | International Journal of ChemTech Research 10 (15), 317-331, 2017 | 0 | 2017 | |
| 468 | Google Scholar | Authors : IK Budaraga | PENGABDIAN KEPADA MASYARAKAT PEMBUATAN RAMUAN ORGANIK TANAMAN (ROTAN) DIKAWASAN EKONOMI MASYARAKAT (KEM) KANAGARIAN TIKA... | UNES Journal of Community Service 2 (2), 127-134 | 0 | 2017 | |
| 469 | Google Scholar | Authors : IK Budaraga | Effect of Combination Treatment of Concentration Liquid Smoke, Immertion Duration, Packaging and old Type Storage different Levels of Protein Nila Fish Fillet (Oreochromis … | Journal of ChemTech Research 10 (3), 1-10, 2017 | 5 | 2017 | |
| 470 | Google Scholar | Authors : Z I Ketut Budaraga,Fridarti, Salamanang | Pembuatan Pakan Ternak Sapi dari Jerami menggunakan Ramuan Organik Ternak (ROTER) sebagai salah satu perwujudan kegiatan KKN-PPM Pertanian Terinte... | Politeknik Pertanian Negeri Pertanian Payakumbuh 1, 177-198 | 0 | 2016 | |
| 471 | Google Scholar | Authors : CL Suryani, AP Kamarudin, IK Budaraga, N Suhartatik, E Julianti, U Pato, ... | PENGEMBANGAN PANGAN FUNGSIONAL | 0 | 0000 | ||
| 472 | Google Scholar | Authors : YM Sari | Asnurita dan I Ketut Budaraga 2017 | Pengaruh Konsentrasi Starter Acetobacter Xylinum Terhadap Mutu Nata De …, 0 | 0 | 0000 | |
| 473 | Google Scholar | Authors : CL Suryani, AP Kamarudin, IK Budaraga, N Suhartatik, E Julianti, U Pato, ... | PENGEMBANGAN PANGAN FUNGSIONAL | 0 | 0000 | ||
| 474 | IPRs | I Ketut Budaraga, Rera Aga Salihat,Eddwina Aidila Fitria | TEKNOLOGI DAN KARAKTERISTIK KEJU LUNAK :PRODUKSI, MUTU DAN INOVASI | EC002025119777 | 2025 | ||
| 475 | IPRs | Ropiudin, Rusman, Risse Entikaria Rachmanita, I Ketut Budaraga, Dedy Eko Rahmanto, Muchammad Chusnan Aprianto, Sugeng Pramudibyo, Dion Eko Prihandono | Teknologi Energi Terbarukan | EC002024194190 | 2024 | ||
| 476 | IPRs | Indrawaty Sitepu, Halimatus Sa’diyah, Mahbub Zuhri, Novi Nur Lailisna, Khairiah, Fitra, Azmi, Siti Azizah, Erlinda Yurisinthae, I Ketut Budaraga | Filsafat Ilmu dan Metode Ilmiah | EC00202439778 | 2024 | ||
| 477 | IPRs | I Ketut Budaraga, Mac Aditiawarman, Andy Amiruddin, Hary Fandeli, Wawan Sumarno, Rera Agung Syukra | TEKNOLOGI PENGOLAHAN KELAPA TERPADU BESERTA BERBAGAI TUTORIAL PENGOLAHAN POHON KELAPA | EC00202470953 | 2024 | ||
| 478 | IPRs | Anna Permatasari Kamarudin, Eko Sutrisno, Suwari Akhmaddhian, Eka Wisdawati, Sama' Iradat Tito, Parwiyanti, Mohammad Mardiyanto, I Ketut Budaraga, Nurhayati | Ketahanan Pangan dan Kearifan lokal | EC00202403134 | 2024 | ||
| 479 | IPRs | Nurhayati I Ketut Budaraga Nurul Fajrih H. Soraya Kusuma Putri Juni Sumarmono Rahmaniar Rifda Naufalin Santi Dwi Astuti Sri Widowati | Ilmu Pangan Jilid 2 | EC002024221093 | 2024 | ||
| 480 | IPRs | Nurhayati, Sri Widowati, Cynthia Gracia Christina Lopulalan, I Ketut Budaraga, Erismar Amri , Chatarina Lilis Suryani, Santi Dwi Astuti , Herlina, Nurma Handayani ,Edi Susilo | ILMU PANGAN JILID 1 | EC002024212346 | 2024 | ||
| 481 | IPRs | Muhammad Parikesit Wisnubroto, Paskarada Juanti, Rahmah Utami Budiandari, I Ketut Budaraga, Tiara Kumala, Hetty Sri Mulyati, Rita Hayati, Christian Yosua Salomo, Dwiyati Pujimulyani, Gusti Setiavani | TEKNOLOGI PENGOLAHAN HASIL PERKEBUNAN | EC00202444712 | 2024 | ||
| 482 | IPRs | Ari Kristiningsih Sawarni Hasibuan Hermawan Samsu Adi Rahman Nurhayati Adrianus Orias Willem Kaya Dheasy Herawati Salnida Yuniarti Lumbessy I Ketut Budaraga,Fadly Irmawan | Teknologi Pengolahan Rumput Laut | EC00202497329 | 2024 | ||
| 483 | IPRs | Ika Gusriani, Santi Dwi Astuti, Usman Pato, Herianus Justhianus D. Lalel dkk. | Ilmu Bahan Pangan | EC00202432262 | 2024 | ||
| 484 | IPRs | I Ketut Budaraga, Andy Amiruddin | PERANAN TEKNOLOGI PENGOLAHAN DAN PENGAWETAN PANGAN BERBASIS SUMBER DAYA DAN KEARIFAN LOKAL UNTUK MEWUJUDKAN PANGAN SEHAT | EC00202420497 | 2024 | ||
| 485 | IPRs | Rahmadina, I Ketut Budaraga, Endang Verawati, Devi Bunga Pagalla, Irman Irawan, Arina Fatharani, Rahmawati | Fisiologi Pascapanen | EC002024256317 | 2024 | ||
| 486 | IPRs | Muhammad Iqbal Fanani Gunawan, Andini Putri Riandani, Erna Rusliana Muhamad Saleh, Indah Rodianawati, I Ketut Budaraga, Sri Surani, Syarifa Ramadhani Nurbaya, Santi Dwi Astuti, Nurhayati, Zalfadhiyaa Naufal Fayyadh | Teknik Evaluasi Sensori Produk Pangan | EC00202445806 | 2024 | ||
| 487 | IPRs | Nurhayati, Chatarina Lilis Suryani, Usman Pato dkk | Pengembangan Pangan Fungsional | EC00202457007 | 2024 | ||
| 488 | IPRs | Ropiudin, Rusman, Risse Entikaria Rachmanita, I Ketut Budaraga, Dedy Eko Rahmanto, Muchammad Chusnan Aprianto, Sugeng Pramudibyo, Dion Eko Prihandono | Teknologi Energi Terbarukan | EC002024194190 | 2024 | ||
| 489 | IPRs | Indrawaty Sitepu, Halimatus Sa’diyah, Mahbub Zuhri, Novi Nur Lailisna, Khairiah, Fitra, Azmi, Siti Azizah, Erlinda Yurisinthae, I Ketut Budaraga | Filsafat Ilmu dan Metode Ilmiah | EC00202439778 | 2024 | ||
| 490 | IPRs | I Ketut Budaraga, Mac Aditiawarman, Andy Amiruddin, Hary Fandeli, Wawan Sumarno, Rera Agung Syukra | TEKNOLOGI PENGOLAHAN KELAPA TERPADU BESERTA BERBAGAI TUTORIAL PENGOLAHAN POHON KELAPA | EC00202470953 | 2024 | ||
| 491 | IPRs | Anna Permatasari Kamarudin, Eko Sutrisno, Suwari Akhmaddhian, Eka Wisdawati, Sama' Iradat Tito, Parwiyanti, Mohammad Mardiyanto, I Ketut Budaraga, Nurhayati | Ketahanan Pangan dan Kearifan lokal | EC00202403134 | 2024 | ||
| 492 | IPRs | Nurhayati I Ketut Budaraga Nurul Fajrih H. Soraya Kusuma Putri Juni Sumarmono Rahmaniar Rifda Naufalin Santi Dwi Astuti Sri Widowati | Ilmu Pangan Jilid 2 | EC002024221093 | 2024 | ||
| 493 | IPRs | LPPM Universitas Ekasakti | FORMULASI EDIBLE FILM DENGAN PENAMBAHAN BELIMBING WULUH (Averrhoa Bilimbi L.) | S00202309391 | 2023 | ||
| 494 | IPRs | LPPM Universitas Ekasakti | ALAT PEMBUAT ASAP CAIR DENGAN SISTEM VAKUM | S00202213155 | 2022 | ||
| 495 | IPRs | LPPM Universitas Ekasakti | KEJU COTTAGE DARI SUSU SAPI DENGAN PENAMBAHAN BELIMBING WULUH | S00202213154 | 2022 | ||
| 496 | IPRs | LPPM Universitas Ekasakti | PROSES PEMBUATAN ASAP CAIR DENGAN SISTEM VAKUM | S00202213156 | 2022 | ||
| 497 | IPRs | I Ketut Budaraga | Buku Liquid Smoke Toxicity With Variation Of Temperature And Concentration | 000129575 | 2018 | ||
| 498 | IPRs | I Ketut Budaraga | Disertasi:Potensi Asap Cair Dari Berbagai Sumber Dan Aplikasinya Sebagai Pengawet Fillet Ikan Nila (Oreochromis Nilotica) | 000109419 | 2018 | ||
| 499 | IPRs | I Ketut Budaraga,yossi oktavia | Kajian Mutu Minuman Segar Corens Dengan Penggunaan Berbagai Jenis Jeruk | 000129574 | 2018 | ||
| 500 | IPRs | I Ketut Budaraga | Laporan penelitian: Kajian Mutu Fillet Lele Asap Yang Diberikan Asap Cair Kayu Manis | 000109449 | 2018 | ||
| 501 | IPRs | LPPM Universitas Ekasakti | KOMPOR BRIKET TAHAN PANAS | S00201000249 | 2010 | ||
| 502 | Buku | Prof. Dr. Ir. I Ketut Budaraga, M.Si. CIRR, Rera Aga Salihat, S.Si., M.Si, Eddwina Aidila Fitria, STP., M.Si | Teknologi dan karakteristik keju lunak : produksi, mutu, dan inovasi | CV. Hei Publishing Indonesia | 2025 | ||
| 503 | Buku | Prof. Dr. Ir. I Ketut Budaraga, M.Si. CIRR, Rera Aga Salihat, S.Si., M.Si, Eddwina Aidila Fitria, STP., M.Si | Transportasi Pertanian: Kolaborasi Untuk Ketahanan Pangan | CV. Hei Publishing Indonesia | 2025 | ||
| 504 | Buku | Nurhayati, Chatarina Lilis Suryani, Anna Permatasari Kamarudin, Rohadi, I Ketut Budaraga, Pahman Habibi [dan 7 lainnya] ; editor, Nur Ahmad Habibi, S.Gz., M.P., : Muslimah, S.Tr.Kes., | Pengembangan pangan fungsional | Hei Publishing Indonesia | 2024 | ||
| 505 | Buku | Nurhayati, Chatarina Lilis Suryani, Anna Permatasari Kamarudin, Rohadi, I Ketut Budaraga, Pahman Habibi [dan 7 lainnya] ; editor, Nur Ahmad Habibi, S.Gz., M.P., : Muslimah, S.Tr.Kes., | Ilmu Teknologi Hasil Ternak | Hei Publishing Indonesia | 2024 | ||
| 506 | Buku | Nurhayati, Chatarina Lilis Suryani, Anna Permatasari Kamarudin, Rohadi, I Ketut Budaraga, Pahman Habibi [dan 7 lainnya] ; editor, Nur Ahmad Habibi, S.Gz., M.P., : Muslimah, S.Tr.Kes., | TEKNOLOGI PENGOLAHAN DAN HASIL PERTANIAN | Hei Publishing Indonesia | 2024 | ||
| 507 | Buku | Nurhayati, Chatarina Lilis Suryani, Anna Permatasari Kamarudin, Rohadi, I Ketut Budaraga, Pahman Habibi [dan 7 lainnya] ; editor, Nur Ahmad Habibi, S.Gz., M.P., : Muslimah, S.Tr.Kes., | Rekayasa Bioenergi | Hei Publishing Indonesia | 2024 | ||
| 508 | Buku | Nurhayati, Chatarina Lilis Suryani, Anna Permatasari Kamarudin, Rohadi, I Ketut Budaraga, Pahman Habibi [dan 7 lainnya] ; editor, Nur Ahmad Habibi, S.Gz., M.P., : Muslimah, S.Tr.Kes., | Teknologi Pengolahan Rumput Laut | Hei Publishing Indonesia | 2024 |
Sumber data: SINTA, per 7 Oktober 2025
© 2025 LPPM Universitas Ekasakti. All rights reserved.
© 2025 LPPM Universitas Ekasakti. All rights reserved.
