Daftar Dosen per Program Studi
| No | Nama Lengkap | NIDN / NUPTK | Jabatan | Kepangkatan | Publikasi | Penelitian | Pengabdian | IPRs | Buku | |||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Scopus | Scholar | Garuda | Rama | |||||||||
| 1 | DIAN PRAMANA PUTRA, S.TP, M.P. | 1012109001 / 0344768669130323 | Asisten Ahli | Penata Muda Tk. I / III/b |
9 Cited: 22 |
42 Cited: 131 |
6 Cited: 0 |
0 | 2 | 1 | 0 | 0 |
| 2 | EDDWINA AIDILA FITRIA, S.TP, M.Si | 1007058703 / 3839767668237022 | Lektor | Penata / III/c |
4 Cited: 4 |
50 Cited: 86 |
15 Cited: 0 |
0 | 4 | 0 | 1 | 2 |
| 3 | Dr I KETUT BUDARAGA, Ir, M.Si | 0022066801 / 7054746647130083 | Profesor | Pembina Utama Madya / IV/d |
31 Cited: 121 |
388 Cited: 966 |
17 Cited: 0 |
0 | 9 | 6 | 28 | 29 |
| 4 | INAWATY SIDABALOK, Ir, M.Si | 0026126802 / 5558746647230073 | Lektor Kepala | Pembina Tk. I / IV/b |
0 Cited: 0 |
33 Cited: 106 |
19 Cited: 0 |
0 | 2 | 1 | 2 | 1 |
| 5 | LEFFY HERMALENA, S.Pi, M.Si | 1015037601 / 0647754655230142 | Lektor | Penata Tk. I / III/d |
4 Cited: 4 |
69 Cited: 88 |
25 Cited: 0 |
0 | 2 | 0 | 4 | 2 |
| 6 | Dr NITA YESSIRITA, Ir, M.P. | 0012096601 / 7541744645230073 | Lektor Kepala | Pembina Utama Muda / IV/c |
8 Cited: 7 |
88 Cited: 114 |
16 Cited: 0 |
0 | 7 | 1 | 10 | 4 |
| 7 | RERA AGA SALIHAT, S.Si, M.Si | 1001119101 / 7433769670130323 | Lektor | Penata Tk. I / III/d |
10 Cited: 15 |
45 Cited: 113 |
19 Cited: 0 |
0 | 4 | 1 | 2 | 1 |
| 8 | YURNALIS, Ir, M.P. | 1008086401 / 4140742643230103 | Lektor | Penata Tk. I / III/d |
0 Cited: 0 |
27 Cited: 36 |
8 Cited: 0 |
0 | 2 | 5 | 0 | 0 |
Daftar Kegiatan Dosen
| No | Kategori Kegiatan | Authors | Judul Kegiatan | Publikasi | Cited | Quality | Tahun Kegiatan |
|---|---|---|---|---|---|---|---|
| 1 | Google Scholar | Authors : | 0 | 2000 | |||
| 2 | Garuda | Basalius; Inawaty Sidabalok; Nita Yessirita; Leffy Hermalena; Rera Aga Salihat; Eddwina Aidila Fitria | - Maize Nugget Making in Nagari Ladang Panjang, Pasaman Regency, West Sumatra: Pembuatan Nugget Jagung di Nagari Ladang Panjang, Kabupaten Pasaman, Sumatera Barat | Jurnal Research Ilmu Pertanian Vol. 5 No. 1 (2025): Jurnal Research Ilmu Pertanian (Februari 2025)15-23 | 4 | 2023 | |
| 3 | Google Scholar | Authors : IK Budaraga, EA Fitria | -Maize Nugget Making in Nagari Ladang Panjang, Pasaman Regency, West Sumatra | Dinamisia: Jurnal Pengabdian Kepada Masyarakat 7 (4), 1184-1189, 2023 | 1 | 2023 | |
| 4 | Google Scholar | Authors : IK Budaraga, EA Fitria | -Maize Nugget Making in Nagari Ladang Panjang, Pasaman Regency, West Sumatra: Pembuatan Nugget Jagung di Nagari Ladang Panjang, Kabupaten Pasaman, Sumatera Barat | Dinamisia: Jurnal Pengabdian Kepada Masyarakat 7 (4), 1184-1189, 2023 | 1 | 2023 | |
| 5 | Google Scholar | Authors : IK Budaraga, WS Devi | ‘Penguatan Ketahanan Masyarakat dalam Menghadapi Era New Normal melalui Penerapan Teknologi Tepat Guna Bidang Pertanian’Potensi Budidaya Tanaman Hias di Kelompok Wanita Tani … | Semin. Nas. Pengabdi 1 (1), 59-65, 2021 | 1 | 2021 | |
| 6 | Google Scholar | Authors : JR Leke | (Peer Review) The Characteristics and Quality of Egg from Commercial Laying Hens Fed with Garlic (Allium Sativum) Supplemented Ration | Fakultas Peternakan Universitas Jenderal Soedirman, 2019 | 0 | 2019 | |
| 7 | Google Scholar | Authors : IK Budaraga, RA Salihat, EA Fitria | Acidification effects of starfruit (Averrhoa bilimbi L.) on soy milk-based cottage cheese: a physicochemical and organoleptic assessment | Potravinarstvo Slovak Journal of Food Sciences 17, 986-996, 2023 | 2 | 2023 | |
| 8 | Google Scholar | Authors : IK Budaraga, RA Salihat, EA Fitria | Acidification effects of starfruit (Averrhoa Bilimbi L.) on soy milk-based cottage cheese: A physicochemical and organoleptic assessment. | Potravinarstvo Slovak Journal of Food Sciences 17, 986-996, 2023 | 2 | 2023 | |
| 9 | Google Scholar | Authors : I Sidabalok | AKTIFITAS ANTIBAKTERI VINEGAR BERAS KETAN MERAH DAN KETAN PUTIH TERHADAP BAKTERI GRAM POSITIF DAN GRAM NEGATIF | Seminar Nasional Multi Disiplin Ilmu Universitas Asahan, 2019 | 0 | 2019 | |
| 10 | Google Scholar | Authors : IK Budaraga | Alat Pembuat Asap cair dengan Sistem Vakum | 0 | 2023 | ||
| 11 | Google Scholar | Authors : IK Budaraga, L Hermalena, S Aisyah | Alginate Addition from Sargassum Seaweed (Sargassum sp.) on Pumpkin Ice Cream (Cucurbita Moschata Durch.) Characteristics | Annals of Agri-Bio Research 29 (2), 15-26, 2024 | 1 | 2024 | |
| 12 | Google Scholar | Authors : DP Putra, RA Salihat, NR Yanti | ANALISIS KIMIA, MIKROBIOLOGI DAN ORGANOLEPTIK MARGARIN YANG MEMANFAATKAN BUBUK ANGKAK SEBAGAI PEWARNA ALAMI | Jurnal Teknologi Pertanian Andalas 26 (2), 239-247, 2022 | 1 | 2022 | |
| 13 | Google Scholar | Authors : DP Putra, RA Salihat, NR Yanti | Analisis kimia, mikrobiologi, dan organoleptik margarin yang memanfaatkan bubuk angkak sebagai pewarna alami | J. Teknol. Pertan. Andalas 26 (2), 239-248, 2022 | 1 | 2022 | |
| 14 | Penelitian | Eddwina Aidila Fitria | ANALISIS METODE MEMASAK IKAN ASAP UNTUK MENGURANGI KANDUNGAN KARSINOGENIK (BENZO@PYRENE) |
Penelitian Kompetitif Nasional ( PDP/Dosen Pemula ) Leader: Ainul Mardiah Sumber: BIMA SOURCE Status: Approved Dana: Rp14.899.000 |
2019 | ||
| 15 | Google Scholar | Authors : A Mardiah | Analisis organoleptik ikan asap yang diolah secara tradisional | UNES Journal of Scientech Research 3 (2), 101-109, 2018 | 13 | 2018 | |
| 16 | Penelitian | Leffy Hermalena | ANALISIS RANTAI PASOK DALAM PERSPEKTIF PENGEMBANGAN BERAS SOLOK SEBAGAI KOMODITAS UNGGUL SPESIFIC LOCAL SUMATERA BARAT |
Penelitian Kompetitif Nasional ( PDP/Dosen Pemula ) Leader: Richardo Sumber: SIMLITABMAS SOURCE Status: Approved Dana: Rp20.000.000 |
2017 | ||
| 17 | Google Scholar | Authors : L Hermalena, RA Salihat | ANALISIS SENYAWA KIMIA PADA BAKSO IKAN TETELAN MERAH TUNA DENGAN PENAMBAHAN JAMUR TIRAM PUTIH (Pleurotus ostreatus) DENGAN METODE GC-MS | Menara Ilmu 12 (2), 2018 | 3 | 2018 | |
| 18 | Garuda | Kartika Ariyanti; Yurnalis; Rera Aga Salihat | ANALISIS SENYAWA KIMIA PADA BAKSO IKAN TETELAN MERAH TUNA DENGAN PENAMBAHAN JAMUR TIRAM PUTIH (Pleurotus ostreatus)DENGAN METODE GC-MS | Jurnal Research Ilmu Pertanian Vol. 2 No. 2 (2022): Jurnal Research Ilmu Pertanian (Agustus 2022)182-192 | Accred : Unknown | 2018 | |
| 19 | Google Scholar | Authors : LH dan Rera Aga Salihat | Analisis Senyawa Kimia Pada Bakso Ikan Tetelan Merah Tuna Penambahan Jamur Tiram Putih (Pleurotus ostreatus) dengan Metode GC-MS | Menara Ilmu 2 (Vol. XII No. 79), 124 | 0 | 2018 | |
| 20 | Google Scholar | Authors : IK Budaraga, DP Putra | Analysis antioxidant IC50 liquid smoke of cocoa skin with several purification methods | IOP Conference Series: Earth and Environmental Science 757 (1), 012053, 2021 | 8 | 2021 | |
| 21 | Google Scholar | Authors : G Zulfitriyana, H Gusvita, IK Budaraga | Analysis Of Factors Affecting Demand Red Chili Pepper (Capsicum Annum L) In Solok And Effort Fulfillment | Int. J. Sci. Technol. Res 4 (8), 2015 | 3 | 2015 | |
| 22 | Google Scholar | Authors : H Gusvita, IK Budaraga | Analysis Of Factors Affecting Demand Red Chili Pepper Capsicum Annum L In Solok And Effort Fulfillment | International Journal of Scientific & Technology Research 4 (8), 159-173, 2015 | 0 | 2015 | |
| 23 | Google Scholar | Authors : IK Budaraga, A Arnim, Y Marlinda, U Bulain | Analysis of liquid smoke chemical components with GC MS from different raw materials variation production and pyrolysis temperature level | International Journal of ChemTech Research 9 (06), 694-708, 2016 | 45 | 2016 | |
| 24 | Scopus | Creator : Ketut Budaraga I. | Analysis of liquid smoke chemical components with GC MS from different raw materials variation production and pyrolysis temperaturelevel | International Journal of Chemtech Research | 26 | no-Q as Journal | 2016 |
| 25 | Google Scholar | Authors : IK Budaraga, RA Salihat | Analysis of metals (Pb, Mn, Cd, Zn, Cu) in purple rice and purple rice stems cultivated organically using biogas slug in Padang Pariaman, West Sumatra Province | IOP Conference Series: Earth and Environmental Science 709 (1), 012071, 2021 | 7 | 2021 | |
| 26 | Google Scholar | Authors : DS Chaerani, H Gusvita, Z Khairani, FM Yusuf, N Yessirita | Analysis of Social Capital and Income of Gapoktan Tunas Muda in Padang, West Sumatra | TEC EMPRESARIAL 18 (1), 543-559, 2023 | 0 | 2023 | |
| 27 | Google Scholar | Authors : D Syukri, AA Fitri | Andalasian International Journal of Social and Entrepreneurial Development (AIJSED) | 0 | 0000 | ||
| 28 | Google Scholar | Authors : IK Budaraga, D Pramana Putra, W Wellyalina | Antibacterial activity of moringa leaf layer cake against S. aureus and E. coli | Journal of Applied Agricultural Science and Technology 4 (1), 694-708, 2020 | 8 | 2020 | |
| 29 | Google Scholar | Authors : IK Budaraga, A Arnim, Y Marlinda, U Bulain | Antibacterial Properties of Liquid Smoke from the Production of Cinnamon How Purification and Concentration of Different | International Journal of Thesis Projects and Dissertations (IJTPD) 4 (2 …, 2016 | 10 | 2016 | |
| 30 | Google Scholar | Authors : IK Budaraga | Antibacterial Properties of Liquid Smoke from Various Raw Materials with Different Pyrolysis Temperature Level | International Journal of ChemTech Research 10 (5), 31-45, 2017 | 1 | 2017 | |
| 31 | Google Scholar | Authors : IK Budaraga, N Yulita, N Yessirita | Antibacterial study of cocoa skin liquid smoke in raw milk | IOP Conference Series: Earth and Environmental Science 803 (1), 012034, 2021 | 5 | 2021 | |
| 32 | Google Scholar | Authors : IK Budaraga, D Pramana Putra, Y Yanti | Antimicrobial Activity and Liquid Smoke Minimum Kill Concentration of Cocoa Shell on the Growth of the Lasiodiplodia Theobromae Fungi | 0 | 2021 | ||
| 33 | Scopus | Creator : Budaraga I.K. | Antioxidant Activity of ‘Broken Skin’ Purple Rice, ‘Skinned’ Purple Rice, and Purple Rice Stem Organically Cultivated in Indonesia | International Journal on Advanced Science Engineering and Information Technology | 5 | Q2 as Journal | 2020 |
| 34 | Google Scholar | Authors : IK Budaraga, RA Salihat | Antioxidant activity of ‘broken skin’purple rice,‘skinned’purple rice, and purple rice stem organically cultivated in Indonesia | International Journal on Advanced Science, Engineering and Information …, 2020 | 7 | 2020 | |
| 35 | Google Scholar | Authors : L Hermalena, HR Oktavia, EA Fitria | ANTIOXIDANT ACTIVITY OF YELLOW PUMPKIN NOODLES (Cucurbita moschata Durch) WITH TUNA BONE MEAL | JURNAL KATALISATOR 8 (2), 386-395, 2023 | 0 | 2023 | |
| 36 | Google Scholar | Authors : IK Budaraga, A Arnim, Y Marlinda, U Bulain | Antioxidant properties of liquid smoke cinnamon production of variation of purification and different concentration | International Journal of Scientific & Technology Research 5 (6), 266-273, 2013 | 12 | 2013 | |
| 37 | Google Scholar | Authors : A BudaragaIK, UB YettiMarlida | Antioxidant Properties of Liquid Smoke Cinnamon Production of Variation Purification and Different Concentration | International Journal of Scientific & Technology Research (IJSTR). ISSN ISSN … | 3 | 2016 | |
| 38 | Google Scholar | Authors : IK Budaraga, A Arnim, Y Marlinda, U Bulain | Antioxidant properties of liquid smoke production variation of pyrolysis temperature raw and different concentration | Journal of PharmTech Research 9 (6), 366-379, 2016 | 9 | 2016 | |
| 39 | Google Scholar | Authors : IK Budaraga, DP Putra | Antioxidant study of the gambier leaves by-products into tea with red ginger powder addition (Zingiber officinale var. Rubrum) | AIP Conference Proceedings 2583 (1), 090023, 2023 | 0 | 2023 | |
| 40 | Google Scholar | Authors : EL Sembara, Yurnalis, RA Salihat | Aplikasi Edible Coating Pati Talas Dengan Gliserol Sebagai Plasticizer Pada Penyimpanan Cabai Merah (Capsicum Annum L.) | Journal of Scientech Research and Development 3 (2), 134-145, 2021 | 5 | 2021 | |
| 41 | Google Scholar | Authors : EL Sembara, Yurnalis, RA Salihat | Aplikasi edible coating pati talas dengan gliserol sebagai plasticizer pada penyimpanan cabai merah (Capsicum annum L) | Journal of Scientech Riset and Development 3 (2), 134 - 145, 2021 | 2 | 2021 | |
| 42 | Google Scholar | Authors : I Nurhakim, L Hermalena, EA Fitria | APLIKASI EDIBLE FILM DARI PATI TALAS DENGAN PENAMBAHAN GELATIN CEKER AYAM PADA MAKANAN TRADISIONAL “BAREH RANDANG | Journal of Scientech Research and Development 3 (2), 162-178, 2021 | 2 | 2021 | |
| 43 | Garuda | Leffy Hermalena; Hafiva Reski Oktavia; Eddwina Aidila Fitria | APLIKASI EDIBLE FILM DARI PATI TALAS DENGAN PENAMBAHAN GELATIN CEKER AYAM PADA MAKANAN TRADISIONAL âBAREH RANDANG" | JURNAL KATALISATOR Vol. 8 No. 2 (2023): Jurnal Katalisator Volume 8 No. 2, Oktober 2023386-395 | 3 | 2021 | |
| 44 | Google Scholar | Authors : M Murnita, L Hermalena | APLIKASI MULSA PLASTIK HITAM PERAK (MPHP) PADA BUDIDAYA TANAMAN CABAI KERITING (Capsicum annum L.) | Martabe: Jurnal Pengabdian Kepada Masyarakat 4 (2), 432-438, 2021 | 1 | 2021 | |
| 45 | Google Scholar | Authors : IK Budaraga, L Hermalena, S Susanti | Application of Chitosan Coating and Liquid Smoke as Antimicrobial Agent in Tuna Fish Pempek | Jurnal Gizi dan Pangan 18 (Supp. 1), 81-83, 2023 | 1 | 2023 | |
| 46 | Google Scholar | Authors : I Sidabalok, EA Fitria, A Susanto, I Karina | APPLICATION OF EDIBLE COATING BREADFRUIT STARCH AGAINST CAYENNE PEPPER | Jurnal Teknologi Industri Pertanian 33 (1), 72-78, 2023 | 2 | 2023 | |
| 47 | Google Scholar | Authors : I Sidabalok, EA Fitria, A Susanto, I Karina | APPLICATION OF EDIBLE COATING BREADFRUIT STARCH AGAINST CAYENNE PEPPER (Capsicum frustescens) STORAGE AT ROOM TEMPERATURE. | Journal of Agroindustrial Technology/Jurnal Teknologi Industri Pertanian 33 (1), 2023 | 0 | 2023 | |
| 48 | Google Scholar | Authors : IK Budaraga | Arnim; Marlida, Y.; Bulanin, U., Analysis of liquid smoke chemical components with GC MS from different raw materials variation production and pyrolysis temperature level | Int. J. ChemTech Res 9, 694-708, 2016 | 3 | 2016 | |
| 49 | Google Scholar | Authors : IK Budaraga, Y Marlida, U Bulanin | Arnim.(2017). Chemical components analysis of Cinnamon liquid smoke with GC MS from various production of different purification method | International Journal of Chemical Technology Research 10 (1), 12-26 | 6 | 0000 | |
| 50 | Google Scholar | Authors : YM Sari | Asnurita dan I Ketut Budaraga 2017 | Pengaruh Konsentrasi Starter Acetobacter Xylinum Terhadap Mutu Nata De …, 0 | 0 | 0000 | |
| 51 | Google Scholar | Authors : RA Syukra, RA Salihat, M Nuraini | Association of Coral Life Form with Megabenthos, Pasumpahan Island, Padang City | Jurnal Biologi Tropis 25 (2), 1557-1565, 2025 | 0 | 2025 | |
| 52 | Google Scholar | Authors : IK Budaraga | BAB 2 ILMU SUSU | ILMU PANGAN JILID 2, 15, 0 | 0 | 0000 | |
| 53 | Google Scholar | Authors : IK Budaraga | BAB 4 ILMU SAGU | ILMU PANGAN JILID, 53, 0 | 0 | 0000 | |
| 54 | Google Scholar | Authors : IK Budaraga, F Fridarti | Biogas Technology Application As One Of The Realization Of Kkn Ppm Integrated In Agricultural District Kanagarian kasang Batang Anai Padang Pariaman | 0 | 2016 | ||
| 55 | Google Scholar | Authors : DP Putra, H Herwina, MN Janra | Breeding efforts on wild honey bee Apis cerana Fabr. within coconut plantations in Padang Pariaman, west Sumatra | IOP Conference Series: Earth and Environmental Science 757 (1), 012024, 2021 | 5 | 2021 | |
| 56 | Google Scholar | Authors : MS Asnurita, II Sidabalok, MP Ir Afrida, MP Ir Yonny Arita Taher | BUKU AJAR BIOKIMIA UMUM | Lawyers Office Mai Wandeu Press, 2021 | 0 | 2021 | |
| 57 | Google Scholar | Authors : ISHS diyah Mahbub Zuhri Novi Nur Lailisna Khairiah Fitra Azmi Siti Azizah ... | Buku Filsafat Ilmu Dan Metode Ilmiah | IN Patent EC00,202,439,778, 2024 | 0 | 2024 | |
| 58 | Google Scholar | Authors : HTPSKDYHAFAPBEMITQAAFESIK Budaraga | Buku Konsep Pemberdayaan Masyarakat | IN Patent EC00,202,449,833, 2024 | 0 | 2024 | |
| 59 | Google Scholar | Authors : IK Budaraga | Buku Liquid Smoke Toxicity With Variation Of Temperature And Concentration | 0 | 2018 | ||
| 60 | Buku | penulis, I Ketut Budaraga ; editor, Dendi Kurniawan | Buku manual cara membuat asap cair dari kulit buah kakao dan aplikasi sebagai pestisida tanaman kakao | Lembaga Penelitian dan Pengabdian Kepada Masyaraka | 2019 | ||
| 61 | Google Scholar | Authors : IK Budaraga | Buku manual Cara Pembuatan Asap Cair dari Buah Kakao dan Aplikasi Sebagai Pestisida Tanaman Kakao | 0 | 2019 | ||
| 62 | Google Scholar | Authors : IK Budaraga | Buku Manual Cara Pembuatan Asap Cair Dari Buah Kulit Kakao Dan Aplikasi Sebagai Pestisida Alami Pada Tanaman Kakao | 0 | 2019 | ||
| 63 | Google Scholar | Authors : HP Sari, SK Sari, S Syamsuwirman, SIS Islami, RNR Novitasari, ... | BUKU PANDUAN SEKOLAH IKLIM PETANI PEREMPUAN (SIPP) | PKBI Sumbar Publisher, 2024 | 0 | 2024 | |
| 64 | Google Scholar | Authors : SK Sari, HP Sari, S Islami, R Novitasari, L Hermalena, B Permana | BUKU PANDUAN SEKOLAH IKLIM PETANI PEREMPUAN (SIPP): Mitigasi dan Adaptasi Dampak Perubahan Iklim | PKBI Sumbar Publisher, 2024 | 0 | 2024 | |
| 65 | Google Scholar | Authors : AA I Ketut Budaraga | Buku Peranan Teknologi Pengolahan Dan Pengawetan Pangan Berbasis Sumber Daya Dan Kearifan Lokal Untuk Mewujudkan Pangan Sehat | IN Patent EC00,202,420,497, 2024 | 0 | 2024 | |
| 66 | Buku | Marsetyo dkk/Editor: Eddy Jajang Jaya Atmaja | Buku praktis pedoman tekhnis cara pelaksanaan fermentasi lamtoro menggunakan bakteri dan jamur untuk pakan ternak unggas | CV Hei Publishing | 2025 | ||
| 67 | Google Scholar | Authors : MIFGAPRERMSIRIKBSSSRNSDANNZN Fayyadh | Buku Teknik Evaluasi Sensori Produk Pangan | IN Patent EC00,202,445,806, 2024 | 0 | 2024 | |
| 68 | Google Scholar | Authors : RDEKERMSDAPADPNEPEKHKRCPTFYSSNIK Budaraga | Buku Teknologi Pengolahan Dan Hasil Pertanian | IN Patent EC00,202,442,132, 2024 | 0 | 2024 | |
| 69 | Google Scholar | Authors : MPWPRUBIKBTKHSMRHCYSADPG Setiavani | Buku Teknologi Pengolahan Hasil Perkebunan | IN Patent EC00,202,444,712, 2024 | 0 | 2024 | |
| 70 | Google Scholar | Authors : L Hermalena, M Noer, N Nazir, RA Hadiguna | Carrageenan Raw Material Supply Projection in The Seaweed Production Center Area in Takalar Regency, South Sulawesi Province | Business Review and Case Studies 5 (3), 341-341, 2024 | 0 | 2024 | |
| 71 | Google Scholar | Authors : IK Budaraga, A Fridarti, E Usnel | Cattle cow dung use as an alternative energy source and organic fertilizer friendly enviroment village Kasang districts Batang Anai Padang Pariaman | Int J Sci Technol Res 4 (8), 171-175, 2015 | 3 | 2015 | |
| 72 | Google Scholar | Authors : Novelina, Novizar Nazir, Risa Meutia Fiana, Dian Permana Putra | Characteristics of Black Glutinous Rice Vinegar as Traditionally Fermented Product of Yeast Tapai and Acetobacter aceti | IOP Conf. Series: Earth and Environmental Science 347, 2019 | 1 | 2019 | |
| 73 | Google Scholar | Authors : AH Samudra, RA Salihat, IK Budaraga | Characteristics of Brown Rice (Oryza nivara) Stored Using Various Packaging with The Addition of Pandanus Powder (Pandanus amaryllifolius Roxb.) | Springer Nature, 2023 | 0 | 2023 | |
| 74 | Google Scholar | Authors : IK Budaraga, A Arnim, Y Marlinda, U Bulain | Characteristics of cinnamon liquid smoke produced using several purification techniques | American Journal of Food Science and Nutrition Research 3 (2), 16-21, 2016 | 11 | 2016 | |
| 75 | Google Scholar | Authors : IK Budaraga, L Hermalena, I Ahsan | Characteristics of Maco Fish (Leiognathidae Spelendes) Using Coconut Shell Liquid Smoke as A Natural Preservative | BIO Web of Conferences 69, 03003, 2023 | 0 | 2023 | |
| 76 | Google Scholar | Authors : IK Budaraga, I Sidabalok, SA Rasyid | Characteristics of pensi pempek (Corbicula moltkiana) on tapioca flour substitution with sago flour | BIO Web of Conferences 159, 01006, 2025 | 0 | 2025 | |
| 77 | Google Scholar | Authors : IK Budaraga, S Wahyuni, A Asnurita | Characteristics of Physical and Chemical of Cocoa Skin Liquid Smoke (Treoboma Cacao L.) on different Moisture Content | 0 | 2018 | ||
| 78 | Google Scholar | Authors : EA Fitria, L Hermalena, N Saputri, N Yessirita, I Sidabalok | CHARACTERISTICS OF RED DRAGON FRUIT SKIN DRY NOODLES (Hylocereus polyrhizus) WITH THE ADDITION OF TUNA FISH BONE MEAL | Jurnal Katalisator 9 (1), 172-183, 2024 | 0 | 2024 | |
| 79 | Google Scholar | Authors : N Yessirita, WS Devi, L Hermalena, RA Salihat, Sunadi, Syamsuwirman | Characteristics of Steamed Brownies based on Fermented Coffee Fruit Skin by Rhizopus Oryzae | International Journal of Life Science and Agriculture Research 3 (12), 1004-1008, 2024 | 0 | 2024 | |
| 80 | Google Scholar | Authors : IK Budaraga, DP Putra | Characteristics of the liquid chemical properties of cocoa skin [Theobroma cacao L.] in different water levels | IOP Conference Series: Earth and Environmental Science 497 (1), 012016, 2020 | 2 | 2020 | |
| 81 | Google Scholar | Authors : I Sidabalok, RA Salihat, M Farid, EA Fitria | CHEMICAL AND ORGANOLEPTIC CHARACTERISTICS OF DONUTS FROM SEVERAL TYPES OF SWEET POTATO FLOUR | Jurnal Katalisator 9 (1), 49-61, 2024 | 0 | 2024 | |
| 82 | Google Scholar | Authors : IK Budaraga, A Arnim, Y Marlinda, U Bulain | Chemical Components Analysis of Cinnamon Liquid Smoke with GC MS from Various Production of different Purification Method | International Journal of ChemTech Research 10 (1), 12-26, 2017 | 10 | 2017 | |
| 83 | Google Scholar | Authors : YA Taher, A Afrida, Y Desi, B Badal, I Sidabalok, A Asnurita, M Meriati | Community Economic Empowerment With Maize Cultivation In Nagari Tuik Iv Koto Mudiek, Batang Kapas District, South Coast Regency: Community Economic Empowerment With Maize … | Journal of Community Service and Application of Science 1 (2), 85-91, 2022 | 0 | 2022 | |
| 84 | Google Scholar | Authors : YA Taher, A Afrida, Y Desi, B Badal, I Sidabalok | Community Economic Empowerment With Maize Cultivation In Nagari Tuik Iv Koto Mudiek, Batang Kapas District, South Coast Regency: Pemberdayaan Ekonomi Masyarakat Dengan Budidaya … | Journal of Community Service and Application of Science 1 (2), 85-91, 2022 | 0 | 2022 | |
| 85 | Garuda | Rumondang Rumondang; Juliwati P. Batubara; Inawaty Sidabalok; Umaiyu Siregar; Syafrida Br. Tambunan | Community Economic Empowerment With Maize Cultivation In Nagari Tuik Iv Koto Mudiek, Batang Kapas District, South Coast Regency: Pemberdayaan Ekonomi Masyarakat Dengan Budidaya Jagung Di Nagari Tuik Iv Koto Mudiek Kecamatan Batang Kapas Kabupaten Pesisir Selatan | BERNAS: Jurnal Pengabdian Kepada Masyarakat Vol. 5 No. 1 (2024)1115-1120 | 4 | 2022 | |
| 86 | Google Scholar | Authors : IK Budaraga | Dampak Bahaya Senyawa Benzoepiren yang terdapat dalam asap cair | Buletin Ilmiah Ekasakti 22 (1), 8-27, 2012 | 0 | 2012 | |
| 87 | Google Scholar | Authors : KM Hanafi, I Sidabalok, J Messa | Development Of High Yield Potential Cassava As Food Resources And Renewable Energy | 0 | 0000 | ||
| 88 | Google Scholar | Authors : IK Budaraga | Disertasi POTENSI ASAP CAIR DARI BERBAGAI SUMBER DAN APLIKASINYA SEBAGAI PENGAWET FILLET IKAN NILA (Oreochromis nilotica) | Ilmu Pertanian program pasca sarjana Universitas Andalas, 2016 | 0 | 2016 | |
| 89 | Google Scholar | Authors : IK Budaraga | Disertasi:Potensi Asap Cair Dari Berbagai Sumber Dan Aplikasinya Sebagai Pengawet Fillet Ikan Nila (Oreochromis Nilotica) | 0 | 2018 | ||
| 90 | Google Scholar | Authors : Y Yurnalis, EA Fitria, TR Witri | Efektifitas Kemasan Antimikroba Lengkuas Pada Pempek Selama Penyimpanan | Sagu 21 (2), 64-69, 2022 | 1 | 2022 | |
| 91 | Penelitian | Sunadi; Tinda Afriyani | Efektivitas Bacillus laterosporus pada Fermentasi Tepung daun Lamtoro (Leucaena leucocephala) dengan Penambahan Supplemen Metionin-Lisin terhadap Produktivitas dan Penurunan Kolesterol Telur Itik Pitalah |
Penelitian Kompetitif Nasional ( PPT/Produk Terapan ) Leader: Nita Yessirita Sumber: BIMA SOURCE Status: Approved Dana: Rp50.000.000 |
2016 | ||
| 92 | Google Scholar | Authors : IK Budaraga | Effect Combination Treatment Different Concentration of Liquid Smoke, Immersion Duration, Packaging and Storage Duration to Organoleptic quality Fillet Tilapia Fi... | 0 | 2016 | ||
| 93 | Google Scholar | Authors : B I Ketut, Arnim, M Yetti, B Usman | Effect Combination Treatment Different Concentration of Liquid Smoke, Immersion Duration, Packaging and Storage Duration to Organoleptic quality Fillet Tilapia Fish … | International Journal of Advanced Scientific and Technical Research 6 (2 … | 1 | 2016 | |
| 94 | Google Scholar | Authors : UB I Ketut Budaraga,Arnim,YettiMarlida | Effect Combination Treatment Different Concentration of Liquid Smoke, Immersion Duration, Packaging and Storage Duration to Organoleptic quality Fillet Tilapia Fish (Oreochromisniloticus) | International Journal of Advanced Scientific and Technical Research Issue 6 ... | 0 | 2016 | |
| 95 | Google Scholar | Authors : A Yasthophi, RA Salihat, A Alif, H Aziz, E Munaf | Effect of coating ceramic membranes with TiO2 to the performance of electrolyte photovoltaic cell with KI/KI3 solution and carbon as electrode | Journal of Chemical and Pharmaceutical Research 7 (3), 2302-2308, 2015 | 0 | 2015 | |
| 96 | Google Scholar | Authors : IK Budaraga | Effect of Combination Treatment of Concentration Liquid Smoke, Immersion Duration. Packaging and Old Type Storage different Levels of Fat Fish Tilapia Fillet (Or... | International Journal of ChemTech Research 11 (02), 244-254 | 1 | 2018 | |
| 97 | Google Scholar | Authors : IK Budaraga | Effect of Combination Treatment of Concentration Liquid Smoke, Immersion Duration. Packaging and Old Type Storage different Levels of Fat Fish Tilapia Fillet (Oreochromis … | International Journal of ChemTech Research 11 (02), 244-254, 2018 | 3 | 2018 | |
| 98 | Google Scholar | Authors : IK Budaraga | Effect of Combination Treatment of Concentration Liquid Smoke, Immersion Duration, Packaging and Long Storage different Levels of Antibacterials Nila Fish Fillet | International Journal of ChemTech Research 10 (15), 317-331, 2017 | 0 | 2017 | |
| 99 | Google Scholar | Authors : IK Budaraga | Effect of Combination Treatment of Concentration Liquid Smoke, Immersion Duration, Packaging and Long Storage different Levels of Antibacterials Nila Fish Fillet (... | International Journal of ChemTech Research 10 (no.15), 317-331 | 1 | 2017 | |
| 100 | Google Scholar | Authors : IK Budaraga | Effect of Combination Treatment of Concentration Liquid Smoke, Immersion Duration, Packaging and Long Storage different Levels of Antibacterials Nila Fish Fillet (Oreochromis … | International Journal of ChemTech Research 10 (15), 317-331, 2017 | 0 | 2017 | |
| 101 | Google Scholar | Authors : IK Budaraga | Effect of Combination Treatment of Concentration Liquid Smoke, Immersion Duration, Packaging and Long Storage different Levels of Antioxidant Tilapia Fish Fillet (... | International Journal of ChemTech Research 10 (nomor 15), 332-343 | 1 | 2017 | |
| 102 | Google Scholar | Authors : IK Budaraga | Effect of Combination Treatment of Concentration Liquid Smoke, Immersion Duration, Packaging and Long Storage different Levels of Antioxidant Tilapia Fish Fillet (Oreochromis … | International Journal of ChemTech Research 10 (nomor 15), 332-343 | 2 | 2017 | |
| 103 | Google Scholar | Authors : IK Budaraga | Effect Of Combination Treatment Of Concentration Liquid Smoke, Immersion Duration, Packaging And Old Type Storage Different Levels Of Fiber And Ash Fish Tilapia Fillet … | International Journal of ChemTech Research 11 (No.08), 347-365 | 2 | 2018 | |
| 104 | Google Scholar | Authors : IK Budaraga | Effect of Combination Treatment Of Concentration Liquid Smoke, Immersion Duration, Packaging And Old Type Storage Different Levels Of Phenol And Carbonil Nila Fish Fillet … | International Journal of ChemTech Research 11 (08), 364-380, 2018 | 3 | 2018 | |
| 105 | Google Scholar | Authors : IK Budaraga | Effect of Combination Treatment of Concentration Liquid Smoke, Immertion Duration, Packaging and old Type Storage different Levels of Protein Nila Fish Fillet (Oreochromis … | Journal of ChemTech Research 10 (3), 1-10, 2017 | 5 | 2017 | |
| 106 | Google Scholar | Authors : IK Budaraga | Effect of Combination Treatment of Concentration Liquid Smoke, Immertion Duration, Packaging and old Type Storagedifferent Levels of Protein Nila Fish Fillet | 3 | 2017 | ||
| 107 | Google Scholar | Authors : IK Budaraga | Effect of Combination Treatment of Concentration Liquid Smoke, Immertion Duration, Packaging and old Type Storagedifferent Levels of Protein Nila Fish Fillet (Ore... | International Journal of ChemTech Research, 01-10 | 1 | 2017 | |
| 108 | Google Scholar | Authors : IK Budaraga | Effect of Combination Treatment of Concentration Liquid Smoke, Immertion Duration, Packaging and old Type Storagedifferent Levels of Protein Nila Fish Fillet (Oreochromis … | International Journal of ChemTech Research, 01-10 | 2 | 2017 | |
| 109 | Google Scholar | Authors : IK Budaraga | Effect of Combination Treatment of Concentration Liquid Smoke, Immertion Duration, Packaging and old Type Storagedifferent Levels of Protein Nila Fish Fillet (Oreochromis niloticus) | International Journal of ChemTech Research, 01-10 | 0 | 2017 | |
| 110 | Google Scholar | Authors : IK Budaraga | Effect of Combination Treatment of Liquid Smoke Concentration, Soaking Time, Packaging and Different Storage Time To Yield And Moisture Content nila Fish Fillet (Oreochromis … | International Journal of ChemTech Research 10 (1), 77-88, 2017 | 1 | 2017 | |
| 111 | Google Scholar | Authors : IK Budaraga | Effect of Combination Treatment of Liquid Smoke Concentration, Soaking Time, Packaging and Different Storage Time To Yield And Moisture Contentnila Fish Fillet | 0 | 0000 | ||
| 112 | Google Scholar | Authors : IK Budaraga | Effect of Combination Treatment of Liquid Smoke Concentration, Soaking Time, Packaging and Different Storage Time To Yield And Moisture Contentnila Fish Fillet (... | International Journal of ChemTech Research 10 (Vol.10 No.1 pp 77-88, 2017 … | 1 | 2017 | |
| 113 | Google Scholar | Authors : IK Budaraga | Effect of Combination Treatment of Liquid Smoke Concentration, Soaking Time, Packaging and Different Storage Time To Yield And Moisture Contentnila Fish Fillet (Oreochromis … | International Journal of ChemTech Research 10 (Vol.10 No.1 pp 77-88, 2017 … | 0 | 2017 | |
| 114 | Google Scholar | Authors : IK Budaraga | Effect of Combination Treatment of Liquid Smoke Concentration, Soaking Time, Packaging and Different Storage Time To Yield And Moisture Contentnila Fish Fillet (Oreochromis niloticus) | International Journal of ChemTech Research 10 (Vol.10 No.1 pp 77-88, 2017 ... | 0 | 2017 | |
| 115 | Google Scholar | Authors : N Yessiirta, H Abbas, A Dharma, H Heryandi | Effect of Dose and Time of Lamtoro Leaf Meal (leucaena leucocephala) Fermentation with Bacillus laterosporus to Dry Matter, Crude Protein and Crude Fiber | Proceedings The first. Poultry International Seminar 6 (1), 386-392, 2012 | 0 | 2012 | |
| 116 | Google Scholar | Authors : S Syamsuwirman, IK Budaraga, T Tukiran | EFFECT OF GRANTING FEED OF NPK FERTILIZER FERTILIZER TO GROWTH AND RESULT CAISIM PLANT (Brassica Juncea L) | UNES Journal Of Scientech research 2 (2), 218-228, 2017 | 0 | 2017 | |
| 117 | Google Scholar | Authors : N Yessirita, Sunadi, DP Putra, Rici | Effect of Soaking Time with Acetic acid on tuna skin gelatin (thunnus albacores) | Journal of Scientific and Engineering Research 10 (5), 82 - 87, 2023 | 0 | 2023 | |
| 118 | Google Scholar | Authors : RA Salihat, A Yasthophi, A Alif, H Aziz | Effects of pv cell modification to its performance in generating current and voltage with KI/KI3 electrolytes system | Journal of Chemical and Pharmaceutical Research 7 (4), 605-614, 2015 | 0 | 2015 | |
| 119 | Garuda | Muhammad Haikal Hirzi; Yurnalis; Inawaty Sidabalok | EKTSRAK DAUN SIRIH (Piper betle L) UNTUK PENCEGAHAN IFEKSI JAMUR SAPROLEGNIA SP. PADA TELUR IKAN PATIN SIAM (Pangasius hypopthalmus) | Jurnal Research Ilmu Pertanian Vol. 2 No. 1 (2022): Jurnal Research Ilmu Pertanian (Februari 2022)64-77 | Accred : Unknown | 2013 | |
| 120 | Google Scholar | Authors : I Sidabalok | ENVIRONMENT ISSUES DUE TO OVERLY USE OF CHEMICAL FERTILIZERS IN PALM TREES PLANTATIONS | Asian Journal of Natural & Applied Sciences Vol 6, 2, 2017 | 0 | 2017 | |
| 121 | Google Scholar | Authors : RAH Leffy Hermalena, Melinda Noer, Novizar Nazir | Environmental-Based Supply Chain Integration for the Development of Carrageenan Production Centers in Laikang Village Takalar Regency, South Sulawesi Province | Journal Of Environmental & Earth Sciences 4 (7), 96-125, 2025 | 0 | 2025 | |
| 122 | Google Scholar | Authors : G Gusriati, A Armia, IK Budaraga | ESTABLISHING ORGANIC RICE PRODUCTION: TECHNICAL, ECONOMIC AND SOCIAL CONSTRAINTS (Case Study on Organic Farmers in Nagari Sariek Alahan Tigo, Hiliran Gumanti Sub-District … | UNES Journal of Agricultural Scienties 1 (2), 167-175 | 0 | 2017 | |
| 123 | Google Scholar | Authors : IKB Gusriati 1), Armia2) | ESTABLISHING ORGANIC RICE PRODUCTION: TECHNICAL, ECONOMIC AND SOCIAL CONSTRAINTS (Case Study on Organic Farmers in Nagari Sariek Alahan... | UNES Journal Agricultural Scienties 1 (2), 167-175 | 0 | 2017 | |
| 124 | Penelitian | Eddwina Aidila Fitria | Evaluasi Komponen Karsinogenik Penyebab Kanker pada Ikan Asap yang dipasarkan Secara Tradisional untuk Keamanan Pangan |
Penelitian Kompetitif Nasional ( PDP/Dosen Pemula ) Leader: Ainul Mardiah Sumber: BIMA SOURCE Status: Approved Dana: Rp17.775.000 |
2018 | ||
| 125 | Google Scholar | Authors : IK Budaraga | Faktor Proses Pengolahan Dengan Pemanasan | Hei Publishing Indonesia, 2024 | 0 | 2024 | |
| 126 | Google Scholar | Authors : A Aisyah, G Gusriati, IK Budaraga | FAKTOR-FAKTOR YANG MEMPENGARUHI PRODUKSI KARET (Havea brasiliensis) DI KABUPATEN PASAMAN PROVINSI SUMATERA BARAT | UNES Journal of Scientech Research 1 (1), 065-074, 2016 | 1 | 2016 | |
| 127 | Google Scholar | Authors : N YESSIRITA | Fermentasi Tepung Daun Lamtoro Dengan Bacillus Laterosporus Meningkatkan Kualitas Gizi Pakan Broiler | Jurnal Bibiet 1 (1), 1-8, 2016 | 1 | 2016 | |
| 128 | Google Scholar | Authors : I Sitepu, H Sa'diyah, M Zuhri, N Lailisna, Khairiyah, Fitra, Azmi, S Azizah, ... | Filsafat Ilmu dan Metode Ilmiah | Hei Publishing 1, 89-101, 2024 | 0 | 2024 | |
| 129 | Buku | Nurhayati, I Ketut Budaraga, Nurul Fajrih H., Soraya Kusuma Putri, Juni Sumarmono, Rahmaniar, Rifda Naufalin, Santi Dwi Astuti, Sri Widowati | Fisiologi Pascapanen | CV HEI Publishing | 2024 | ||
| 130 | Google Scholar | Authors : F Widodo, D Lo, SC Rahım, HK Yildirim, K Chiravi, DD Wadikar, MA Khan, ... | Food Science and Applied Biotechnology | Food Science 8 (1), 2025 | 0 | 2025 | |
| 131 | IPRs | LPPM Universitas Ekasakti | FORMULASI EDIBLE FILM DENGAN PENAMBAHAN BELIMBING WULUH (Averrhoa Bilimbi L.) | S00202309391 | 2023 | ||
| 132 | Garuda | Basalius; Inawaty Sidabalok; Nita Yessirita; Leffy Hermalena; Rera Aga Salihat; Eddwina Aidila Fitria | Fortifikasi Kalsium Pada Kerupuk Ubi Kamang Dengan Tepung Tulang Ikan Tuna (Thunnus sp.) | Jurnal Research Ilmu Pertanian Vol. 5 No. 1 (2025): Jurnal Research Ilmu Pertanian (Februari 2025)15-23 | 4 | 2025 | |
| 133 | Google Scholar | Authors : A Kasirang, K Ekasari, I Sidabalok, L Fudjaja, J Kamaruzaman, Akhsan, ... | Gender Dimension of Ethnic Bugis and Makassar Women Empowerment | World Applied Sciences Journal 26 (January), 17 -23, 2013 | 5 | 2013 | |
| 134 | Google Scholar | Authors : R Rini, K Sayuti, F Azima, EA Fitria | Hand sanitizer with eucalyptus scent for the community as a contribution to dealing with pandemic conditions: a community service report | Andalasian International Journal of Social and Entrepreneurial Development 1 …, 2021 | 1 | 2021 | |
| 135 | Google Scholar | Authors : RA Salihat | Heavy metals analysis (Cd, Pb, Zn, Cu, Cr) and Calcium in Padang and Padang Panjang | 0 | 0000 | ||
| 136 | Google Scholar | Authors : I Ketut Budaraga, RA Salihat | Heavy metals analysis (Cd, Pb, Zn, Cu, Cr) and calcium in Padang and Padang Panjang fresh cow's milk | IOP Conference Series: Earth and Environmental Science 1038 (1), 012076, 2022 | 2 | 2022 | |
| 137 | Google Scholar | Authors : IK Budaraga, RA Salihat | Heavy metals analysis (Cd, Pb, Zn, Cu, Cr) and calcium in Padang and Padang Panjang fresh cow’s milk | IOP Conference Series: Earth and Environmental Science 1038 (1), 012076, 2022 | 3 | 2022 | |
| 138 | Scopus | Creator : Sunadi | Hepatitis E Inhibited by Rosmarinic Acid Extract from Clove Plant (Syzygium Aromaricum) through Computational Analysis | Pharmacognosy Journal | 0 | Q3 as Journal | 2023 |
| 139 | Google Scholar | Authors : IK Budaraga, A Asnurita | IBM Kelompok Budidaya Ikan Maju Bersama | Jurnal Penelitian dan Kajian Ilmiah Menara Ilmu 8 (53), 37-43, 2014 | 0 | 2014 | |
| 140 | Pengabdian | Prima Novia | IbM KELOMPOK ORGANISASI PADAT KARYA 4 SAJAREK |
Pengabdian Kepada Masyarakat Kompetitif Nasional ( PKM ) Leader: I Ketut Budaraga Sumber: SIMLITABMAS SOURCE Status: Approved Dana: Rp48.000.000 |
2014 | ||
| 141 | Google Scholar | Authors : IK Budaraga, G Gusriati | Ibm Kelompok Tani Tagamang Bajawek di Kabupaten Padang Pariaman | Jurnal Penelitian dan Kajian Ilmiah Menara Ilmu 3 (44), 52-57, 2014 | 0 | 2014 | |
| 142 | Google Scholar | Authors : G I Ketut Budaraga | Ibm Kelompok Tani Tagamang Bajawek di Kabupaten Padang Pariaman Sumbar | Menara Ilmu 140 (Vol.VIII No. 44 Jan.2014 ISSN 1693-2617), 57-66, 2014 | 0 | 2014 | |
| 143 | Pengabdian | Yurnalis | IbM KELOMPOK TANI TEBU SIRANGKAK GADANG DAN SARUNAI MAIMBAU |
Pengabdian Kepada Masyarakat Kompetitif Nasional ( PKM ) Leader: I Ketut Budaraga Sumber: BIMA SOURCE Status: Approved Dana: Rp42.500.000 |
2015 | ||
| 144 | Google Scholar | Authors : G I Ketut Budaraga | Ibm Kelompok Usaha Roda Banting dan Kelompok Tani Rambai Sakato di Kota Pariaman | Menara Ilmu 190 (Vol VIII no. 41 Okt 2013 ISSN 1693-2617), 38-43, 2013 | 0 | 2013 | |
| 145 | Pengabdian | Andi Kasirang T Baso | IbM PKK Parangloe |
Pengabdian Kepada Masyarakat Kompetitif Nasional ( PKM ) Leader: Inawaty Sidabalok Sumber: SIMLITABMAS SOURCE Status: Approved Dana: Rp40.000.000 |
2013 | ||
| 146 | Google Scholar | Authors : S I Ketut Budaraga1,*, Eddwina Aidila Fitria1 | Identification of Salmonella SP on Food Preparations (Seasoning and Rakik Chips) in Padang City | Proceeding 2nd International Conference Khairun University (IConKU) 2024 1 …, 2024 | 0 | 2024 | |
| 147 | Google Scholar | Authors : AC MUSTIKANINGRUM | ILMU BAHAN PANGAN | Media Sains Indonesia, 2024 | 0 | 2024 | |
| 148 | Buku | Nurhayati, I Ketut Budaraga, Nurul Fajrih H., Soraya Kusuma Putri, Juni Sumarmono, Rahmaniar, Rifda Naufalin, Santi Dwi Astuti, Sri Widowati | Ilmu Pangan (Jilid 2) | CV HEI Publishing | 2024 | ||
| 149 | Buku | Nurhayati, I Ketut Budaraga, Nurul Fajrih H., Soraya Kusuma Putri, Juni Sumarmono, Rahmaniar, Rifda Naufalin, Santi Dwi Astuti, Sri Widowati | Ilmu Pangan Jilid 1 | CV HEI Publishing | 2024 | ||
| 150 | IPRs | Nurhayati I Ketut Budaraga Nurul Fajrih H. Soraya Kusuma Putri Juni Sumarmono Rahmaniar Rifda Naufalin Santi Dwi Astuti Sri Widowati | Ilmu Pangan Jilid 2 | EC002024221093 | 2024 | ||
| 151 | Google Scholar | Authors : IK Budaraga | Ilmu Sagu | Hei Publishing Indonesia, 2024 | 0 | 2024 | |
| 152 | Google Scholar | Authors : S Sugiarti, DK Sari, D Syukriani, E Zelpina, N Fati, N Nilawati, A Muchlis, ... | Ilmu Teknologi Hasil Ternak | Hei Publishing Indonesia, 2024 | 0 | 2024 | |
| 153 | IPRs | Lembaga Penelitian dan Pengabdian kepada Masyarakat (LPPM) Universitas Ekasakti | Improved quality of lamtoro leaf meal fermented bacillus laterosporus with the addition of suplement methionin lysin syntetic | EC00201979017 | 2017 | ||
| 154 | Google Scholar | Authors : N Yessirita, T Afriani, Sunadi | Improved Quality of Lamtoro Leaf Meal Fermented Bacillus laterosporus with the Addition of Supplement Methionin-lysine Synthetic | Journal of Scientific and Engineering Research 4 (10), 483-488, 2017 | 0 | 2017 | |
| 155 | Google Scholar | Authors : N Yessirita, T Afriani, Sunadi | Improved quality of lamtoro leaf meal fermented Bacillus laterosporus with the addition of supplement methionine-lysine synthetic | Journal of Scientific and Engineering Research 4 (10), 483-488, 2017 | 0 | 2017 | |
| 156 | IPRs | Dr.Ir.Nita Yessirita, MP ; Dr.Ir. Zasmeli Suhaemi, MP dan Dr.Ir. Sunadi, MP | Improvement Crude Fiber Digestibility, N Retention And Tanggal dan tempat diumumkan untuk pertama kali di wilayah Indonesia atau di luar wilayah Indonesia Energy Metabolism Of Broiler Through Fermentation LLM And Methionine-Lysine Suplementation | EC00201972683 | 2019 | ||
| 157 | Google Scholar | Authors : N Yessirita, Z Suhaemi, Yurnalis | Improvement Crude Fiber Digestibility, N Retention And Energy Metabolism Of Broiler Through Fermentation Llm And Methionine-Lysine Suplementation | Journal of Scientific of Engineering Research (JSAER) 6 (9), 192-198, 2019 | 0 | 2019 | |
| 158 | Google Scholar | Authors : N Yessirita, Z Suhaemi, Y Yurnalis | Improvement Crude Fiber Digestibility, N Retention and Energy Metabolism of Broiler through Fermentation LLM and Methionine-Lysine Supplementation | Journal of Scientific and Engineering Research 6 (9), 192-198, 2019 | 0 | 2019 | |
| 159 | Google Scholar | Authors : W Wellyalina, RM Fiana, PKD Hayati, S Febjislami, DP Putra | Improvement of Knowledge and Innovation in the Limau Manis Sejahtera Oyster Mushroom Cultivation Group through a Benchmarking in Sungai Sarik, Padang Pariaman: Improvement Of … | Andalasian International Journal of Social and Entrepreneurial Development 3 …, 2023 | 0 | 2023 | |
| 160 | Garuda | Fiana, Risa Meutia; Febjislami, Shalati; Dewi Hayati, PK; Pramana Putra, Dian; Kurniadi, Deri | Improvement of Knowledge and Innovation in the Limau Manis Sejahtera Oyster Mushroom Cultivation Group through a Benchmarking in Sungai Sarik, Padang Pariaman: Improvement Of Knowledge And Innovation In The Limau Manis Sejahtera Oyster Mushroom Cultivation Group Through A Benchmarking In Sungai Sarik, Padang Pariaman | Andalasian International Journal of Social and Entrepreneurial Development Vol. 4 No. 01 (2024): Andalasian International Journal of Social and Entrepreneurial Development23-26 | Accred : Unknown | 2023 | |
| 161 | Google Scholar | Authors : Y Nita, V Rismi, P Devi, R Rollando, M Riso, Sari, A Muhammad, Thoriq, ... | In Silico Study of Rhamnocitrin Extract from Clove (Syzygium Aromaricum) in Inhibiting Adenosine A1-Adenylate Cyclase Interaction | Pharmacognosy Journal 15 (4), 512-517, 2023 | 3 | 2023 | |
| 162 | Scopus | Creator : Yessirita N. | In Silico Study of Rhamnocitrin Extract from Clove (Syzygium Aromaricum) in Inhibiting Adenosine A1-Adenylate Cyclase Interaction | Pharmacognosy Journal | 3 | Q3 as Journal | 2023 |
| 163 | Google Scholar | Authors : N Yessirita, R Verawati, D Purnamasari, R Rollando, RS Mandeli, ... | In Silico Study of Rhamnocitrin Extract from Clove (Syzygium Aromaricum) in Inhibiting Adenosine A1-Adenylate Cyclase Interaction. | Pharmacognosy Journal 15 (4), 2023 | 0 | 2023 | |
| 164 | Google Scholar | Authors : N Yessirita, R Verawati, D Purnamasari, R Rollando, RS Mandeli, ... | In Silico Study of Rhamnocitrin Extract from Clove Syzygium Aromaricum in Inhibiting Adenosine A1 Adenylate Cyclase Interaction | Pharmacognosy Journal 15 (4), 2023 | 3 | 2023 | |
| 165 | Scopus | Creator : Ketut Budaraga I. | Influence of Liquid Smoke Cinnamon Against Attacks Leaf Rot Disease (Phytophthora Infestans) on Potato (Solanum Tuberosum L.) | Iop Conference Series Earth and Environmental Science | 2 | Q4 as Conference Proceedin | 2019 |
| 166 | Google Scholar | Authors : IK Budaraga | Innovation Coconut Shell Briquette Stove as Alternative Substitution of Fuel Oil in Pariaman | Jurnal Ekotrans Jurnal Pemikiran dan Analisis masalah Ekologi dan …, 2011 | 0 | 2011 | |
| 167 | Google Scholar | Authors : D Yunanda, SR Fitrijal, WG Ndruru, NR Putri, EA Fitria, W Sumarno | INOVASI PEMANFAATAN HASIL SAMPING PEPAYA DALAM PEMBUATAN ABON BERSAMA KWT PUNCO RUYUANG, KECAMATAN PADANG SAGO, PADANG PARIAMAN | Bersama: Jurnal Pengabdian Kepada Masyarakat 3 (1), 30-35, 2025 | 0 | 2025 | |
| 168 | Google Scholar | Authors : MS Ir. I Ketut Budaraga | Inovasi Teknologi Pembuatan briket dari Tempurung Kelapa Sebagai Alternatif Pengganti BBM di Kota Pariaman | Buletin Iptekda LIPI 33 (Edisi Khusus Nov.2009 ISSN 1411-6707), 16-18, 2009 | 0 | 2009 | |
| 169 | Google Scholar | Authors : G I Ketut Budaraga,Rizal Abu | Inovation Cocunut Shell Briquette Production Stove As Alternative Substitution of Fuel Oil In Pariaman | Ekotrans 189 (Vol 11 No.1.Jan 2011 ISSN 1411-4615), 189, 2011 | 0 | 2011 | |
| 170 | Scopus | Creator : Jamilah | Investigating the Impact of Soil pH and Texture on Legume Species Root Nodule Formation | International Journal of Agriculture and Biology | 0 | Q3 as Journal | 2025 |
| 171 | Google Scholar | Authors : N Yessirita, A Abbas, Y Heryandi, A Dharma | Isolasi, Seleksi dan Identifikasi Bacillus SP Sellulolitik Asal Saluran Pencernaan Itik Pitalah Sumatera Barat Sebagai Sumber Inokulum Fermentasi Pakan Berserat T... | Jurnal Penelitian Universitas Jambi Seri Sains 12 (2), 59-65 | 0 | 2010 | |
| 172 | Google Scholar | Authors : N Yessirita, A Abbas, Y Heryandi, A Dharma | Isolasi, Seleksi dan Identifikasi Bacillus SP Sellulolitik Asal Saluran Pencernaan Itik Pitalah Sumatera Barat Sebagai Sumber Inokulum Fermentasi Pakan Berserat Tinggi | Jurnal Penelitian Universitas Jambi Seri Sains 12 (2), 59-65, 2010 | 0 | 2010 | |
| 173 | Google Scholar | Authors : N Yessirita, H Abbas, Y Heryandi, A Dharma, IK Amrullah, DD Bell, ... | Isolation, selection and identification of selulolitic Bacillus sp. from Tractus digestivus of pitalah duck from west sumatera as source of fermentation inoculum of … | Pakistan Journal of Nutrition 12 (7), Pages: 1365-Pages: 1365 | 0 | 2003 | |
| 174 | Google Scholar | Authors : IK Budaraga, R Abu | Jamaludin, 2013 | Kompor Briket Tahan Panas (Paten no. ID S0001244 tanggal 19 Maret 2013 …, 0 | 5 | 0000 | |
| 175 | Google Scholar | Authors : L Hermalena, M Noer, N Nazir, RA Hadiguna | Journal of Scientech Research and Development | Journal of Scientech Research and Development 5 (1), 2023 | 0 | 2023 | |
| 176 | Google Scholar | Authors : TFDANAE AKAR, BDANDTE MOLLIS | Jurnal Katalisator | Jurnal Katalisator 6 (2), 332-343, 2021 | 0 | 2021 | |
| 177 | Google Scholar | Authors : V Rubrum, TTEHHKD GAMBIR | JURNAL RESEARCH ILMU PERTANIAN | 0 | 0000 | ||
| 178 | Google Scholar | Authors : IMP Bungsu, IK Budaraga, N Yessirita | JURNAL RESEARCH ILMU PERTANIAN (JRIP) | 0 | 0000 | ||
| 179 | Google Scholar | Authors : IK Budaraga | Kajian Aktivitas Antioksidan, Tannin dan Kadar Air Teh Hijau Celup Akibat Penambahan Bubuk Jahe Merah (Zingiber officinale Rosc) | UNES Journal of Agricultural Scienties 2 (1), 041-052, 2018 | 2 | 2018 | |
| 180 | Google Scholar | Authors : IKB dan gusriati | Kajian efek antioksidan asap cair kayu manis untuk menghambat oksidasi lemak pada filet ikan nila (oriochromis nilotica) asap selama penyimpanan pada suhu ka... | Ekotrans 214 (Volume.12 No. 1 Januari 2012), 191-214 | 0 | 2012 | |
| 181 | Google Scholar | Authors : IKB dan gusriati | Kajian efek antioksidan asap cair kayu manis untuk menghambat oksidasi lemak pada filet ikan nila (oriochromis nilotica) asap selama penyimpanan pada suhu kamar | Ekotrans 214 (Volume.12 No. 1 Januari 2012), 191-214, 2012 | 0 | 2012 | |
| 182 | Google Scholar | Authors : L Hermalena | Kajian Mutu Abon Ikan Beledang Sukun Muda (Besumu) | UNES Journal Mahasiswa Pertanian 3 (2), 125-135, 2019 | 1 | 2019 | |
| 183 | Google Scholar | Authors : S Wilanda, N Yessirita, IK Budaraga | KAJIAN MUTU DAN AKTIVITAS ANTIOKSIDAN TEH KULIT KOPI (Coffea Canephora) DENGAN PENAMBAHAN DAUN MINT | Jurnal Research Ilmu Pertanian 1 (1), 86-93, 2021 | 7 | 2021 | |
| 184 | Garuda | I Ketut Budaraga; Eddwina Aidila Fitria | KAJIAN MUTU DAN AKTIVITAS ANTIOKSIDAN TEH KULIT KOPI (Coffea Canephora) DENGAN PENAMBAHAN DAUN MINT : Mentha Piperita L | Dinamisia : Jurnal Pengabdian Kepada Masyarakat Vol. 7 No. 4 (2023): Dinamisia: Jurnal Pengabdian Kepada Masyarakat1184-1189 | 3 | 2021 | |
| 185 | Google Scholar | Authors : S Wilanda, N Yessirita, IK Budaraga | Kajian Mutu Dan Aktivitas Antioksidan Teh Kulit Kopi (Coffeacanephora) Dengan Penambahan Daun Mint (Mentha Piperita L) | Jurnal Research Ilmu Pertanian 1 (1), 76-83, 2021 | 12 | 2021 | |
| 186 | Google Scholar | Authors : gusriati I Ketut Budaraga | Kajian Mutu Filet Lele Asap yang diberikan Asap Cair Kayu Manis | Seminar Nasional Peranan Teknologi Pangan dan Gizi Dalam Meningkatkan Mutu …, 2013 | 0 | 2013 | |
| 187 | Penelitian | Gusriati | Kajian Mutu Fillet Lele Asap yang Diberikan Asap Cair Kayu Manis |
Penelitian Kompetitif Nasional ( PPT/Produk Terapan ) Leader: I Ketut Budaraga Sumber: BIMA SOURCE Status: Approved Dana: Rp50.000.000 |
2013 | ||
| 188 | Google Scholar | Authors : G I Ketut Budaraga | Kajian Mutu Kimia Filet Lele Asap yang diberikan asap cair kayu manis | Ekasakti 126 (Volume XXIV No. 1 Januari 2013), 102-120, 2012 | 0 | 2012 | |
| 189 | Google Scholar | Authors : MH Nasution | KAJIAN MUTU MELLORINE SUSU JAGUNG MANIS DAN SARI KACANG MERAH | Jurnal Research Ilmu Pertanian 1 (1), 71-75, 2021 | 1 | 2021 | |
| 190 | Google Scholar | Authors : G I Ketut Budaraga | Kajian Mutu Mikrobiologi Filet Lele Asap yang diberi Asap Cair Kayu Manis | Ekasakti 143 (Vol.24.no.1 Januari 2014 ISSN 0854-8099), 92-108, 2014 | 0 | 2014 | |
| 191 | Google Scholar | Authors : IK Budaraga, G Gusriati | Kajian Mutu Mikrobiologi Fillet Lele Asap yang diberi asap cair kayu manis | Buletin Ilmiah Ekasakti 26 (1), 92-108, 2014 | 0 | 2014 | |
| 192 | Google Scholar | Authors : LH Yosi Oktavia, I Ketut Budaraga | Kajian Mutu Minuman Corens dengan Penggunaan Berbagai Jenis Jeruk | UNES JOURNAL Mahasiswa Pertanian 1 (1), 9 - 20 | 0 | 2017 | |
| 193 | Google Scholar | Authors : IK Budaraga | Kajian Mutu Minuman Segar Corens Dengan Penggunaan Berbagai Jenis Jeruk | 0 | 2018 | ||
| 194 | Google Scholar | Authors : G Budaraga I Ketut | Kajian Mutu Pillet Lele Asap yang Diberikan Asap Cair Kayu Manis | Buletin Ilmiah Ekasakti 26 (1), 0854-8099, 2014 | 0 | 2014 | |
| 195 | Penelitian | - | Kajian Pemanfaatan Asap Cair dari Limbah Kulit Buah Coklat Sebagai Bahan Pengawet Susu Segar |
Penelitian Kompetitif Nasional ( PT ) Leader: I Ketut Budaraga Sumber: SIMLITABMAS SOURCE Status: Approved Dana: Rp156.673.070 |
2021 | ||
| 196 | Google Scholar | Authors : IK Budaraga, L Hermalena, WR Saputra | KAJIAN SIFAT FISIKOKIMIA DAN ORGANOLEPTIK SUSU SAPI MURNI DENGAN PENAMBAHAN ASAP CAIR SELAMA PENYIMPANAN | 0 | 0000 | ||
| 197 | Google Scholar | Authors : IK Budaraga | Karakteristik Asap Cair Kulit Kakao (Theobroma Cacao, l) Pada Air Yang Berbeda | UNES JOURNAL MAHASISWA PERTANIAN 3 (1), 011-019, 2019 | 0 | 2019 | |
| 198 | Google Scholar | Authors : N Putriana, L Hermalena, EA Fitria | Karakteristik Biskuit dari Tepung Bengkuang (Pachyrhizus Erosus) Modifikasi Dan Tepung Ubi Jalar Putih (Ipomea Batatas) | Journal of Scientech Research and Development 5 (2), 645-655, 2023 | 1 | 2023 | |
| 199 | Google Scholar | Authors : Z Romadan, N Yessirita, L Hermalena, I Sidabalok | KARAKTERISTIK BROWNIES PANGGANG DENGAN SUBSTITUSI TEPUNG KULIT ARI KOPI (Coffea sp) | Ekasakti Jurnal Penelitian dan Pengabdian 4 (2), 157-167, 2024 | 0 | 2024 | |
| 200 | Google Scholar | Authors : D Saogo, N Yessirita, L Hermalena | Karakteristik Dadih Susu Sapi Yang Di Fermentasi Dengan Lactobacillus Casei Menggunakan Wadah Yang Berbeda | Jurnal embrio 14 (1), 59-71, 2022 | 0 | 2022 | |
| 201 | Google Scholar | Authors : LU Sutra, L Hermalena, RA Salihat | Karakteristik edible film dari pati jahe gajah (Zingiber officinale) dengan perbandingan gelatin kulit ikan tuna | Journal of Scientech Research and Development 2 (2), 034-045, 2020 | 17 | 2020 | |
| 202 | Google Scholar | Authors : Yurnalis | KARAKTERISTIK ES KRIM SUSU SAPI DAN SUSU JAGUNG MANIS DENGAN PEWARNA ALAMI EKSTRAK KULIT BUAH NAGA | Jurnal Teknologi Pertanian Andalas 28 (2), 92-101, 2024 | 0 | 2024 | |
| 203 | Google Scholar | Authors : Y Yurnalis, N Sa’adaturrifni, RA Salihat, NR Yanti | KARAKTERISTIK ES KRIM SUSU SAPI DAN SUSU JAGUNG MANIS DENGAN PEWARNA ALAMI EKSTRAK KULIT BUAH NAGA | Jurnal Teknologi Pertanian Andalas 28 (2), 92-101, 2024 | 0 | 2024 | |
| 204 | Google Scholar | Authors : Nurwahidah, Yurnalis, RA Salihat | Karakteristik Fisikokimia Es Krim Susu Sapi dan Santan dengan Penambahan Rebung Betung (Dendrocalamus Asper) | Jurnal Research Ilmu Pertanian 4 (2), 116-126, 2024 | 1 | 2024 | |
| 205 | Google Scholar | Authors : A Sofia, N Yessirita, DP Putra | KARAKTERISTIK KOMBUCHA TEH DAUN GAMBIR (Uncaria Gambir Roxb) MENGGUNAKAN GULA TEBU ‘SAKA’ | Jurnal embrio 14 (I a), 20-29, 2022 | 0 | 2022 | |
| 206 | Garuda | Basalius; Inawaty Sidabalok; Nita Yessirita; Leffy Hermalena; Rera Aga Salihat; Eddwina Aidila Fitria | KARAKTERISTIK KOMBUCHA TEH DAUN GAMBIR (Uncaria Gambir Roxb) MENGGUNAKAN GULA TEBU SAKA | Jurnal Research Ilmu Pertanian Vol. 5 No. 1 (2025): Jurnal Research Ilmu Pertanian (Februari 2025)15-23 | 4 | 2022 | |
| 207 | Google Scholar | Authors : DPEB SRIKAYA | KARAKTERISTIK MUTU HARD CANDY DAN AKTIVITAS ANTIOKSIDAN DENGAN PENAMBAHAN EKSTRAK BUAH SRIKAYA (Annona Squamosa L) | Jurnal Pionir LPPM Universitas Asahan Vol 7 (0), 3, 2020 | 0 | 2020 | |
| 208 | Google Scholar | Authors : EA Fitria, R Rosandi, I Sidabalok, L Hermalena, N Yessirita | Karakteristik Mutu Kopi Bubuk Talu Pasaman Barat Dengan Variasi Penambahan Bubuk Kayu Manis (Cassiavera) | Ekasakti Jurnal Penelitian dan Pengabdian 5 (1), 1-7, 2024 | 0 | 2024 | |
| 209 | Google Scholar | Authors : DP Putra, RA Salihat | Karakteristik mutu margarin dengan penambahan bubuk angkak sebagai pewarna alami | Jurnal Teknologi Pangan dan Gizi (Journal of Food Technology and Nutrition …, 2021 | 13 | 2021 | |
| 210 | Google Scholar | Authors : PP DIAN | Karakteristik Mutu Margarin dengan Pencampuran Lemak Kakao dan Minyak VCO (Virgin Coconut Oil) | Universitas Andalas, 2014 | 4 | 2014 | |
| 211 | Google Scholar | Authors : K Ariyanti, Yurnalis, RA Salihat | Karakteristik Mutu Nugget Tempe Selama Penyimpanan dengan Edible Film Pati Talas dan Sari Kunyit (Curcuma domestica val.) | Jurnal Research Ilmu Pertanian 2 (2), 182-192, 2022 | 0 | 2022 | |
| 212 | Google Scholar | Authors : TP Rianti, L Hermalena | KARAKTERISTIK SOSIS IKAN PATIN (Pangasius SP) MENGGUNAKAN BERBAGAI JENIS TEPUNG | UNES Journal Mahasiswa Pertanian 2 (2), 119-127, 2018 | 3 | 2018 | |
| 213 | Google Scholar | Authors : S Jeki, DP Putra | KARAKTERISTIK SOSIS TEMPE MENGGUNAKAN BERBAGAI JENIS TEPUNG | Jurnal Research Ilmu Pertanian 1 (2), 164-183, 2021 | 0 | 2021 | |
| 214 | Penelitian | Rera Aga Salihat | KARATERISTIK MUTU MARGARIN DENGAN PENAMBAHAN BUBUK ANGKAK SEBAGAI PEWARNA ALAMI |
Penelitian Kompetitif Nasional ( PDP/Dosen Pemula ) Leader: Dian Pramana Putra Sumber: BIMA SOURCE Status: Approved Dana: Rp19.998.000 |
2020 | ||
| 215 | Google Scholar | Authors : S Inawaty | Kasirang Andi & Suriani.(2014) | Pemanfaatan Limbah Organik Menjadi Kompos. Majalah Aplikasi Ipteks Ngayah 5, 0 | 2 | 0000 | |
| 216 | Google Scholar | Authors : BK Lahati, Y Nurmayanti, U Pato, STC Murti, IK Budaraga, HJD Lalel, ... | KEAMANAN PANGAN | 0 | 0000 | ||
| 217 | Google Scholar | Authors : IK Budaraga | Keamanan Pangan dan Nutrisi | CVLauk Puyu Press, 2025 | 0 | 2025 | |
| 218 | Google Scholar | Authors : N Yessirita, Z Suhaemi, Yurnalis | Kecernaa Serat Kasar dan Energi Metobolisme Ayam Broiler Diberi ransum Perlakuan Tepung daun lamtoro berbeda Perlakuan | Prosiding Hasil Penelitian Seminar Nasional, Fapet Unja, Jambi 2019, 1-11, 2019 | 0 | 2019 | |
| 219 | Google Scholar | Authors : N Yessirita, Z Suhaemi, Yurnalis | Kecernaan serat kasar dan energi metabolisme ayam yang diberi ransum tepung daun lamtoro dengan beberapa perlakuan | Semiinar nasional , Peternakan Universitas jambi 1 (1), 1-11, 2019 | 0 | 2019 | |
| 220 | Google Scholar | Authors : IK Budaraga, RA Salihat, EA Fitria | Keju Cottage Dari Susu Sapi Dengan Penambahan Belimbing Wuluh | 0 | 2022 | ||
| 221 | Pengabdian | - | Kelompok Tani Tagamang Bajawek di Padang Pariaman Sumbar |
Pengabdian Kepada Masyarakat Kompetitif Nasional ( PKM ) Leader: I Ketut Budaraga Sumber: BIMA SOURCE Status: Approved Dana: Rp45.000.000 |
2013 | ||
| 222 | Buku | Muhammad Iqbal Fanani Gunawan, Andini Putri Riandani, Erna Rusliana Muhamad Saleh, Indah Rodianawati, I Ketut Budaraga, Sri Surani, Syarifa Ramadhani Nurbaya, Santi Dwi Astuti, Nurhayati, Zalfadhiyaa Naufal Fayyadh | Ketahanan Pangan dan Kearifan Lokal | Hei Publishing | 2024 | ||
| 223 | Google Scholar | Authors : AP Kamaruddin, E Sutrisno, S Akhmaddhian, E Wisdawati, SI Tito, ... | Ketahanan Pangan dan Kearifan Lokal | 0 | 2023 | ||
| 224 | Google Scholar | Authors : Y Mayang Sari | Ketut Budaraga Universitas Ekasakti AI 2017 Pengaruh konsentrasi starter acetobacter xylinum terhadap mutu nata de cucumber | J. Pertan. UMSB 1, 2527-3663, 0 | 2 | 0000 | |
| 225 | Google Scholar | Authors : IK Budaraga | Kombinasi penambahan tepung karagenan dengan alkali terhadap terhadap beberapa kualitas bakso ikan tenggiri | Ekasakti 134 (Vol.16 No.1 Jan.2009 ISSN 0854-8099), 78-93, 2009 | 0 | 2009 | |
| 226 | Google Scholar | Authors : J I Ketut Budaraga, Rizal Abu | Kompor Briket Tahan Panas | 0 | 2013 | ||
| 227 | Google Scholar | Authors : A Mardiah, EA Fitria | Komposisi proksimat, tekstur, dan organoleptik ikan asap yang dipasarkan di Pekanbaru, Riau, Indonesia | Prosiding Seminar Nasional Tahunan Hasil Perikanan dan Kelautan 15 (3), 31-38, 2018 | 0 | 2018 | |
| 228 | Google Scholar | Authors : AS Fatmawaty, IK Budaraga, GIA Yekti, R Rizkyanto | Konsep Dasar Pengantar Pangan | 0 | 2025 | ||
| 229 | Google Scholar | Authors : HT Pakpahan, S Kurniasih, Y Heryadi, A Fauziah | Konsep pemberdayaan masyarakat | Hei Publishing Indonesia, 2024 | 8 | 2024 | |
| 230 | Google Scholar | Authors : A Zulhendra, N Yessirita | KUALITAS DADIH SUSU SAPI DENGAN PENAMBAHAN STARTER | Jurnal Research Ilmu Pertanian 1 (1), 73-81, 2021 | 0 | 2021 | |
| 231 | Garuda | Basalius; Inawaty Sidabalok; Nita Yessirita; Leffy Hermalena; Rera Aga Salihat; Eddwina Aidila Fitria | KUALITAS DADIH SUSU SAPI DENGAN PENAMBAHAN STARTER : Lactobacillus casei | Jurnal Research Ilmu Pertanian Vol. 5 No. 1 (2025): Jurnal Research Ilmu Pertanian (Februari 2025)15-23 | 4 | 2021 | |
| 232 | Google Scholar | Authors : A Zulhendra, N Yessirita | KUALITAS DADIH SUSU SAPI DENGAN PENAMBAHAN STARTER (Lactobacillus casei) | Jurnal Research Ilmu Pertanian 1 (1), 62-70, 2021 | 0 | 2021 | |
| 233 | Google Scholar | Authors : A Zulhendra, N Yessirita, W Wellyalina | KUALITAS DADIH SUSU SAPI DENGAN PENAMBAHAN STARTER Lactobacillus casei | Jurnal Research Ilmu Pertanian 1 (1), 62-70, 2021 | 0 | 2021 | |
| 234 | Google Scholar | Authors : D Login | LACAK PESANAN | 0 | 0000 | ||
| 235 | Google Scholar | Authors : IK Budaraga | Laporan Ilmiah | Hei Publishing Indonesia, 2024 | 0 | 2024 | |
| 236 | Google Scholar | Authors : IK Budaraga | Laporan penelitian: Kajian Mutu Fillet Lele Asap Yang Diberikan Asap Cair Kayu Manis | 0 | 2018 | ||
| 237 | Google Scholar | Authors : M Murnita, S Syamsuwirman, HP Sari, L Hermalena, I Sidabalok | Limbah Ternak Sapi dan Padi Sebagai Sumber Pupuk Organik untuk Mendukung Sektor Pertanian | Martabe: Jurnal Pengabdian Kepada Masyarakat 6 (7), 2295-2302, 2023 | 2 | 2023 | |
| 238 | Google Scholar | Authors : IK Budaraga, DP Putra | Liquid smoke antimicrobial test of cocoa fruit peel against eschericia coli and staphylococcus aureus bacteria | IOP Conference Series: Earth and Environmental Science 365 (1), 012049, 2019 | 16 | 2019 | |
| 239 | Google Scholar | Authors : IK Budaraga, A Arnim, Y Marlinda, U Bulain | Liquid smoke production quality from raw materials variation and different pyrolysis temperature | International Journal on Advanced Science, Engineering and Information …, 2016 | 81 | 2016 | |
| 240 | Google Scholar | Authors : B USMAN | Liquid Smoke Toxicity Characteristic from raw Materials Variation Production with Different Temperature and Concentration Level | International Journal of Agricultural Technology 12 (6), 1017-1034, 2016 | 0 | 2016 | |
| 241 | Google Scholar | Authors : IK Budaraga, A Arnim, Y Marlida, U Bulanin | Liquid smoke toxicity characteristic from raw materials variation production with different temperature and concentration level. | 0 | 2016 | ||
| 242 | Google Scholar | Authors : IK Budaraga, UB Arnim, Yetti Marlida | Liquid Smoke Toxicity Properties of Production of Raw Materials With Variation of Temperature and Concentration of Different | International Journal of PharmTech Research 9 (10), 10, 2017 | 9 | 2017 | |
| 243 | Buku | penulis, I Ketut Budaraga ; editor, Dendi Kurniawan | Liquid Smoke Toxicity With Variation Of Temperature And Concentration | Lembaga Penelitian dan Pengabdian Kepada Masyaraka | 2019 | ||
| 244 | Google Scholar | Authors : RAH Leffy Hermalena, Melinda Noer, Novizar Nazir | LITERRATURE REVIEW: KAWASAN SENTRA PRODUKSI RUMPUT LAUT BERKELANJUTAN | Journal of Scientech Researchand Development 5 (IDM), 595 - 612, 2023 | 0 | 2023 | |
| 245 | Garuda | Basalius; Inawaty Sidabalok; Nita Yessirita; Leffy Hermalena; Rera Aga Salihat; Eddwina Aidila Fitria | LITERRATURE REVIEW: KAWASAN SENTRA PRODUKSI RUMPUT LAUT BERKELANJUTAN | Jurnal Research Ilmu Pertanian Vol. 5 No. 1 (2025): Jurnal Research Ilmu Pertanian (Februari 2025)15-23 | 4 | 2023 | |
| 246 | Google Scholar | Authors : L Hermalena, M Noer, N Nazir, RA Hadiguna | LITERRATURE REVIEW: MANAJEMEN RANTAI PASOK AGROINDUSTRI RUMPUT LAUT | Jurnal REKAYASA 12 (02), 130-140, 2022 | 0 | 2022 | |
| 247 | Google Scholar | Authors : IGSDARUPERHJDLUAIKBGEMMNKANAMSK Putri | lmu Bahan Pangan | IN Patent EC00,202,432,262, 2024 | 0 | 2024 | |
| 248 | Google Scholar | Authors : L Hermalena, M Noer, N Nazir, RA Hadiguna | Manajemen Rantai Pasok Agroindustri Rumput Laut | Jurnal Rekayasa 12 (2), 153-163, 2022 | 6 | 2022 | |
| 249 | Google Scholar | Authors : IK Budaraga | MEMBANGUN PRODUKSI PADI ORGANIK: KENDALA TEKNIS, EKONOMIS DAN SOSIAL | UNES JOURNAL OF AGRICULTURAL SCIENTIES 1 (2), 167-175, 2017 | 0 | 2017 | |
| 250 | Google Scholar | Authors : G Gusriati, A Armia, IK Budaraga | MEMBANGUN PRODUKSI PADI ORGANIK: KENDALA TEKNIS, EKONOMIS DAN SOSIAL (Studi Kasus pada Petani Organic di Nagari Sariek Alahan Tigo Kecamatan Hiliran Gumanti Kabupaten Solok) | Unes Journal of Agricultural Scienties 1 (2), 167-175 | 0 | 2017 | |
| 251 | Google Scholar | Authors : IK Budaraga, DP Putra, Y Yanti | Microbial activities and minimum liquid smoke killing concentration made of cacao pod toward Lasiodiplodia theobromae growth | IOP Conference Series: Earth and Environmental Science 1059 (1), 012068, 2022 | 3 | 2022 | |
| 252 | Penelitian | I Ketut Budaraga; Ivonne Ayesha; Nofrita Sandi | Model dan Teknik Pengaturan suhu kelembaban otomatis pada kumbung Jamur Tiram menggunakan Digital Skylite. |
Penelitian Kompetitif Nasional ( PKPT ) Leader: Ananto Sumber: SIMLITABMAS SOURCE Status: Approved Dana: Rp63.555.000 |
2020 | ||
| 253 | Google Scholar | Authors : EA Fitria, E Warsiki, I Yuliasih | Model kinetika perubahan warna label indikator dari klorofil daun singkong (Manihot esculenta Crantz) | Jurnal Teknologi Industri Pertanian 27 (1), 2017 | 12 | 2017 | |
| 254 | Google Scholar | Authors : R Richardo | MODEL RA NTAI PASOK BERAS SOLOK | UNES Journal Of Social and Economics research 2 (2), 150-155, 2017 | 0 | 2017 | |
| 255 | Google Scholar | Authors : IK Budaraga | Model-Model Pemberdayaan Masyarakat | Hei Publishing Indonesia, 2024 | 0 | 2024 | |
| 256 | Google Scholar | Authors : A Ananto | Models and Techniques of Automatic Humidity Temperature setting on Oyster Mushrooms using Digital Skylite | International Journal of ChemTech Research 12 (6), 71-75, 2019 | 0 | 2019 | |
| 257 | Google Scholar | Authors : RM Fiana, S Febjislami, PKD Hayati, DP Putra, D Kurniadi | Mushroom Cultivators to Grow and Develop with Oyster Mushroom Cultivation Business in Perumnas Belimbing Kelurahan Kuranji Sub-District | Andalasian International Journal of Social and Entrepreneurial Development 4 …, 2024 | 0 | 2024 | |
| 258 | Google Scholar | Authors : L Hermalena | MUTU KIMIA DAN KARAKTERISTIK ORGANOLEPTIK BAKSO IKAN TETELAN MERAH TUNA YANG DIFORTIFIKASI TEPUNG JAMUR TIRAM PUTIH (Pleurotus Ost... | UNES Journal of Agricultural Scienties 2 (1), 105-113 | 0 | 2018 | |
| 259 | Google Scholar | Authors : L Hermalena | MUTU KIMIA DAN KARAKTERISTIK ORGANOLEPTIK BAKSO IKAN TETELAN MERAH TUNA YANG DIFORTIFIKASI TEPUNG JAMUR TIRAM PUTIH (Pleurotus Ostreatus) | Journal of Agricultural Scienties 2 (1), 105-113, 2018 | 3 | 2018 | |
| 260 | Google Scholar | Authors : L Hermalena | Mutu mikrobiologis bakso ikan tetelan merah tuna dan jamur tiram putih | UNES Journal of Scientech Research 3 (2), 190-196, 2018 | 1 | 2018 | |
| 261 | Google Scholar | Authors : ENM Lubis, G Ali, R Wikansari, RPA Hasibuan, A Dilham, MUM Putra, ... | No Title Page | 0 | 0000 | ||
| 262 | Google Scholar | Authors : O Sari, EA Fitria, RV Syafira, W Sumarno | OPTIMALISASI PEMANFAATAN HASIL SAMPING PEPAYA UNTUK PEMBUATAN SABUN BERSAMA KWT PUNCO RUYUANG, NAGARI BATU KALANG, KECAMATAN PADANG SAGO, PADANG PARIAMAN | Bersama: Jurnal Pengabdian Kepada Masyarakat 2 (2), 77-83, 2024 | 0 | 2024 | |
| 263 | Google Scholar | Authors : I Permana, L Suhendra | Optimasi konsentrasi VCO dalam mikroemulsi m/a dengan tiga surfaktan sebagai pembawa senyawa bioaktif | Media Ilmiah Teknologi Pangan (Scientific Journal of Food Technology) 2 (2 … | 2 | 2015 | |
| 264 | Google Scholar | Authors : I Permana, L Suhendra, KB Jimbaran | OPTIMASI KONSENTRASI VCO DALAM MIKROEMULSI O/W DENGAN TIGA SURFACTANT SEBAGAI PEMBAWA SENYAWA BIOAKTIF | Media Ilmiah Teknologi Pangan (Scientific Journal of Food Technology) 2 (2 … | 2 | 2015 | |
| 265 | Google Scholar | Authors : L Permana, L Suhendra | Optimasi konsentrasi VCO dalam mikroemulsi O/W dengan tiga surfaktan sebagai pembawa senyawa bioaktif | Media Ilm. Teknol. Pangan 2, 106-114, 2015 | 8 | 2015 | |
| 266 | Google Scholar | Authors : N Yessirta, H Abbas, A Dharma, Y Heryandi | Optimasi pertumbuhan Bacillus sp dari saluran pencernaan itik Pitalah dan penentuan media pengemban terbaik sebagai inokulum fermentasi pakan berserat tinggi | Prosiding Seminar Nasional !! Pengembangan Ternak Lokal 1 (3), 250-259, 2015 | 0 | 2015 | |
| 267 | Google Scholar | Authors : YAA Jamilah , Sunadi , Utama, M. Zulman. Harja. , Yessita, Nita. , Novia, P ... | Optimizing fertilizer packages and soil amendments for corn with Chromolaena odorata liquid organic fertilizer | International Journal of Agricultural Technology 20 (6), 2341-2358, 2024 | 0 | 2024 | |
| 268 | Google Scholar | Authors : N Yessirita | Pedoman Tekhnis cara pelaksanaan fermentasi lamtoro menggunakan bakteri dan jamur untk pakan ternak unggas | ISBN: ISBN: 978-623-92864-2-2 (LPPM Universitas Ekasakti) 1, 40, 2020 | 0 | 2020 | |
| 269 | Google Scholar | Authors : N Yessirita | PEDOMAN TEKHNIS CARA PELAKSANAAN FERMENTASI LAMTORO MENGGUNAKAN BAKTERI DAN JAMUR UNTUK PAKAN TERNAK UNGGAS | 0 | 2020 | ||
| 270 | Google Scholar | Authors : IK Budaraga, S Syafrudin, G Gusriati, W Sumarno | Pelatihan Pemanfaatan Limbah Kelapa (Lidi) Menjadi Kerajinan Tangan di Nagari IV Koto Mudik Kecamatan Batang Kapas Kabupaten Pesisir Selatan | Buletin Udayana Mengabdi 18 (3), 2019 | 0 | 2019 | |
| 271 | Google Scholar | Authors : R Rumondang, JP Batubara, I Sidabalok, SB Tambunan, N Nurhadi, ... | PELATIHAN REHABILITASI MANGROVE DI KABUPATEN BATU BARA | Seminar Nasional Multi Disiplin Ilmu Universitas Asahan 1, 776-780, 2023 | 0 | 2023 | |
| 272 | Buku | Marsetyo dkk/Editor: Eddy Jajang Jaya Atmaja | Pemanfaatan tekhnologi pengolahan tepung eceng gondok untuk meningkatkan performa ayam broiler | CV Hei Publishing | 2025 | ||
| 273 | Google Scholar | Authors : IK Budaraga | Pemanfaatan Air Kelapa menjadi produk kecap dan kesehatan | Buletin Ilmiah EKASAKTI 20 (1), 66-70, 2011 | 0 | 2011 | |
| 274 | Google Scholar | Authors : IK Budaraga | Pemanfaatan Air Kelapa Menjadi Produk Olahan Kecap dan Kesehatan | Buletin Ilmiah Ekasakti 20 (1), 66-70, 2011 | 0 | 2011 | |
| 275 | Google Scholar | Authors : IK Budaraga | Pemanfaatan Asap Cair Tempurung Kelapa sebagai Pengawet Ikan Teri di Kelurahan Pasie Nan Tigo Kecamatan Koto Tangah Kota Padang | Jurnal Ekotrans Jurnal Pemikiran dan Analisis masalah Ekologi dan …, 2010 | 0 | 2010 | |
| 276 | Google Scholar | Authors : Yurnalis | Pemanfaatan Beberapa Jenis Pisang pada Pembuatan Saus | Menara Ilmu 36 (Volume III No.36 Maret 2013), 170-174, 2013 | 0 | 2013 | |
| 277 | Penelitian | Rera Aga Salihat; Eddwina Aidila Fitria | Pemanfaatan Belimbing Wuluh (Averrhoa bilimbi L.) dalam Pembuatan Keju Lunak (Soft Cheese) dengan Metode Asam |
Penelitian Kompetitif Nasional ( PDKN ) Leader: I Ketut Budaraga Sumber: BIMA SOURCE Status: Approved Dana: Rp145.430.000 |
2023 | ||
| 278 | Google Scholar | Authors : Z Suhaemi, Husmaini, E Yerizal, N Yessirita | Pemanfaatan Daun Kelor (Moringa oleifera) dalam Fortifikasi Pembuatan Nugget | Jurnal Ilmu Produksi dan Teknologi Hasil Peternakan 9 (2021), 49-54, 2021 | 50 | 2021 | |
| 279 | Google Scholar | Authors : Yurnalis | Pemanfaatan Kacang Gude (Cajanus Cajan L) Pada Pembuatan Tempe | EKOTRANS 11 (1 Januari 2011), 75-81, 2011 | 0 | 2011 | |
| 280 | Google Scholar | Authors : PK MANIS | PEMANFAATAN KACANG MERAH (Phaseolus vulgaris L) PADA | 0 | 2007 | ||
| 281 | Google Scholar | Authors : Yurnalis | Pemanfaatan Kacang Merah (Phaseolus Vulgaris L) Pada Pembuatan Kecap Manis | EKOTRANS 10 (1 Januari 2010), 85-90, 2010 | 0 | 2010 | |
| 282 | Google Scholar | Authors : EA Fitria | Pemanfaatan Klorofil Sebagai Label Cerdas Indikator Warna. | Bogor Agricultural University (IPB), 2015 | 1 | 2015 | |
| 283 | Google Scholar | Authors : I Sidabalok, A Kasirang, S Suriani | Pemanfaatan limbah organik menjadi kompos | Ngayah: Majalah Aplikasi IPTEKS 5 (2), 156080, 2014 | 9 | 2014 | |
| 284 | Google Scholar | Authors : I Sidabalok | Pemanfaatan Limbah Padat Pabrik kecap sebagai Sumber Bahan Pakan Ternak Ayam Pedaging | Universitas Sumatera Utara, 1998 | 0 | 1998 | |
| 285 | Google Scholar | Authors : N Yessirita, Sunadi | Pemanfaatan tekhnologi pengolahan tepung eceng gondok untuk meningkatkan performa ayam broiler | ISBN: 9786230274534 1, 81, 2023 | 0 | 2023 | |
| 286 | Google Scholar | Authors : Yurnalis | Pemanfaatan Tepung Talas Sebagai Substitusi Tepung Terigu Pada Proses Pembuatan Mie Kering Yang Difortifikasi Dengan Tepung Kacang Merah | EKOTRANS 12 (2 Juli 2012), 107-118, 2012 | 0 | 2012 | |
| 287 | Google Scholar | Authors : R Rumondang, JP Batubara, I Sidabalok, U Siregar, SB Tambunan | Pemberdayaan Dan Pendampingan Masyarakat Dalam Pelestarian Mangrove di Pantai Sejarah Kabupaten Batu Bara | BERNAS: Jurnal Pengabdian Kepada Masyarakat 5 (1), 1115-1120, 2024 | 0 | 2024 | |
| 288 | Google Scholar | Authors : A Kasirang, I Sidabalok | Pemberdayaan wanita nelayan di Kelurahan Cambayya, Kecamatan Ujung Tanah, Kota Makassar: laporan hasil penelitian studi kajian wanita | Pusat Penelitian LP3M, Universitas Islam Makassar, 2006 | 0 | 2006 | |
| 289 | Google Scholar | Authors : L Fitriani, L Hermalena | Pembuatan Cookies Menggunakan Tepung Ubi Jalar Ungu dan Tepung Ubi Jalar Putih | Unes Journal mahasiswa Pertanian 3 (1), 049-057, 2019 | 6 | 2019 | |
| 290 | IPRs | Dr.Ir.Nita Yessirita, MP | Pembuatan pakan lele mandiri | EC00202291178 | 2022 | ||
| 291 | Google Scholar | Authors : Z I Ketut Budaraga,Fridarti, Salamanang | Pembuatan Pakan Ternak Sapi dari Jerami menggunakan Ramuan Organik Ternak (ROTER) sebagai salah satu perwujudan kegiatan KKN-PPM Pertanian Terinte... | Politeknik Pertanian Negeri Pertanian Payakumbuh 1, 177-198 | 0 | 2016 | |
| 292 | Google Scholar | Authors : Z I Ketut Budaraga,Fridarti, Salamanang | Pembuatan Pakan Ternak Sapi dari Jerami menggunakan Ramuan Organik Ternak (ROTER) sebagai salah satu perwujudan kegiatan KKN-PPM Pertanian Terintegrasi di Kanagarian Kasang … | Politeknik Pertanian Negeri Pertanian Payakumbuh 1, 177-198 | 0 | 2016 | |
| 293 | Google Scholar | Authors : Z I Ketut Budaraga,Fridarti, Salamanang | Pembuatan Pakan Ternak Sapi dari Jerami menggunakan Ramuan Organik Ternak (ROTER) sebagai salah satu perwujudan kegiatan KKN-PPM Pertanian Terintegrasi di Kanagarian Kasang Kecamatan Batang Anai Kabupaten Padang Pariaman | Politeknik Pertanian Negeri Pertanian Payakumbuh 1, 177-198 | 0 | 2016 | |
| 294 | Google Scholar | Authors : IK Budaraga | Pembuatan Pakan Ternak Sapi Dari Jerami Menggunakan Ramuan Organik Ternak (Roter) Sebagai Salah Satu Perwujudan Kegiatan Kkn-Ppm Pertanian Terintegrasi Di Kanagarian Kasang … | 0 | 2016 | ||
| 295 | Google Scholar | Authors : B I Ketut, F Fridarti | Pembuatan Pakan Ternak Sapi dari Jerami menggunakan Ramuan Organik Ternak (ROTER) sebagai salah satu perwujudan Kegiatan KKN-PPM Terintegrasi di kanagarian Kasang kecamatan … | Seminar Nasional Politekni Pertanian Negeri Payakumbuh 1 (1), 177-isi, 2016 | 0 | 2016 | |
| 296 | Google Scholar | Authors : M Murnita, Y Desi, L Hermalena | Pembuatan pupuk organik cair urin sapi dan pestisida kenikir serta dampaknya terhadap lingkungan | Martabe: Jurnal Pengabdian Kepada Masyarakat 5 (3), 1156-1163, 2022 | 5 | 2022 | |
| 297 | IPRs | Dr.Ir.Nita Yessirita, MP ; Dr.Ir. Sunadi, MP | PEMBUATAN SILASE DARI LIMBAH JAGUNG PADA KELOMPOK TANI RIMBO MUTUIH, NAGARI PUNGGUANG KASIAK, KECAMATAN LUBUK ALUNG KABUPATEN PADANG PARIAMAN | EC00202449412 | 2024 | ||
| 298 | IPRs | Dr.Ir.Nita Yessirita, MP ; Leffy Hermalena, SPi.,MSI ; Ir. Gusriatii, MP : Ir. Inawaty Sidabalok, MSi dan Herda Gusvita, SP.,MSi | PEMBUATAN SILASE JERAMI PADI UNTUK PAKAN TERNAK | EC002024200843 | 2024 | ||
| 299 | Google Scholar | Authors : M Murnita, S Syamsuwirman, G Gusriati, L Hermalena, N Yessirita | PEMENUHAN SUMBER GIZI MELALUI BUDIDAYA TANAMAN SAYURAN KANGKUNG DENGAN PUPUK KOTORAN AYAM DI PEKARANGAN PANTI ASUHAN ASHABIL RAYYAN | Martabe: Jurnal Pengabdian Kepada Masyarakat 7 (4), 1342-1353, 2024 | 0 | 2024 | |
| 300 | Google Scholar | Authors : EA Fitria, FZ Rasdiana | PEMODELAN STATISTICAL CONTROL DETECTION ADAPTIVE (SCDA) UNTUK MONITORING DAN PREDIKSI VOLUME PRODUKSI CRUDE PALM OIL (CPO) NASIONAL | 0 | 0000 | ||
| 301 | Penelitian | Nita Yessirita; Eti Yerizel | Penambahan tepung daun Kelor dalam pembuatan nugget daging itik sebagai pangan fungsional alternatif guna menurunkan prevalensi Stunting di Sumatera Barat |
Insinas ( IRPI ) Leader: Zasmeli Suhaemi Sumber: BIMA SOURCE Status: Approved Dana: Rp70.000.000 |
2020 | ||
| 302 | Google Scholar | Authors : IK Budaraga | Pendidikan Pemanfaatan Asap Cair Sebagai Pengawet Bahan Pangan yang Ramah Lingkungan | International Conference on Global Education 1, 24-36, 2013 | 2 | 2013 | |
| 303 | Google Scholar | Authors : S Maria, IK Budaraga, L Hermalena | Pendugaan Umur Simpan Minuman Corens Dengan Metode Arrhenius | UNES Journal Mahasiswa Pertanian 1 (1), 034-042, 2017 | 0 | 2017 | |
| 304 | Google Scholar | Authors : Z Mustakim, EA Fitria, IK Budaraga | Pendugaan Umur Simpan Sosis Ikan Patin (Pangasius sp) Yang Dilapisi Edible Coating Pati Talas Antimikroba Sari Belimbing Wuluh (Averrhoa bilimbi L) | Jurnal Research Ilmu Pertanian 5 (2), 199-210, 2025 | 0 | 2025 | |
| 305 | Penelitian | Richardo | Penentuan Kandungan Kimia secara Kuantitatif Penggunaan Jamur Tiram dan Tetelan Merah Tuna pada Pembuatan Bakso Ikan |
Penelitian Kompetitif Nasional ( PDP/Dosen Pemula ) Leader: Leffy Hermalena Sumber: SIMLITABMAS SOURCE Status: Approved Dana: Rp20.000.000 |
2017 | ||
| 306 | Google Scholar | Authors : MS Leffy Hermalena, S.Pi. | PENENTUAN KANDUNGAN KIMIA SECARA KUANTITATIF PENGGUNAAN JAMUR TIRAM DAN TETELAN MERAH TUNA PADA PEMBUATAN BAKSO IKAN | Surat Pencatatan Ciptaan, 2018 | 0 | 2018 | |
| 307 | Google Scholar | Authors : DP Putra, A Asben, N Novelina | Penentuan waktu ekstraksi pigmen angkak dari substrat ampas sagu menggunakan ultrasonic bath | Indonesian Journal of Industrial Research 8 (2), 83-88, 2018 | 4 | 2018 | |
| 308 | Google Scholar | Authors : Y I Ketut Budaraga | Penerapan Iptek Bagi Masyarakat bagi Petani Tebu dan Sarunai Maimbau Di Korong Batang Selasih Kanagarian Bukit Batabuah Kecamatan Canduang Kabupaten Agam | Menara ilmu 220 (Vol 9 j. 1 No.62 Okt 2015 ISSN 1693-2617), 190-205, 2015 | 0 | 2015 | |
| 309 | Google Scholar | Authors : Y I Ketut Budaraga | Penerapan Iptek Bagi Masyarakat bagi Petani Tebu dan Sarunai Maimbau Di Korong Batang Selasih Kanagarian Bukit Batabuah Kecamatan Canduang Kabupaten... | Menara ilmu 220 (Vol 9 j. 1 No.62 Okt 2015 ISSN 1693-2617), 190-205 | 0 | 2015 | |
| 310 | Google Scholar | Authors : IK Budaraga, Y Yurnalis | Penerapan Iptek Bagi Masyarakat Kepada Petani Tebu Sirangkak Gadang dan Sarunai Maimbau di Korong Batang Selasih Kanagarian Bukit Batabuah Kecamatan Canduang Kabupaten Agam | Jurnal Penelitian dan Kajian Ilmiah Menara Ilmu 9 (1), 180-190, 2015 | 0 | 2015 | |
| 311 | Pengabdian | Fridarti | PENERAPAN PERTANIANTERINTEGRASI UNTUK PENINGKATAN PENDAPATAN PETANI DALAM RANGKA MEWUJUDKAN KETAHANAN PANGAN DI NAGARI KASANG KECAMATAN BATANG ANAI KABUPATEN PADANG PARIAMAN |
Pengabdian Kepada Masyarakat Kompetitif Nasional ( KKN-PPM ) Leader: I Ketut Budaraga Sumber: SIMLITABMAS SOURCE Status: Approved Dana: Rp62.500.000 |
2016 | ||
| 312 | IPRs | Dr.Ir. Murnita, MP; Dr.Ir.Nita Yessirita, MP ; Ir. Yonny Arita thaher, MP | PENERAPAN SISTEM INTEGRASI TERNAK SAPI DENGAN TANAMAN PADI | EC00201980690 | 2019 | ||
| 313 | Google Scholar | Authors : Murnita, Y Nita, T Yonny, Arita | Penerapan Sistem Integrasi Ternak Sapi dan Tanaman Padi | Jurnal Hilirisasi IPTEKS 2 (3b), 292-304, 0 | 7 | 0000 | |
| 314 | Pengabdian | Syamsuwirman; Yurnalis | Penerapan Teknologi Pembuatan Saus Tomat dengan Substitusi Pepaya dan Penambahan Ubi Jalar Sebagai Bahan Pengental di Gapoktan Diamers Koto Baru Kabupaten Tanah Datar |
Pengabdian Kepada Masyarakat Kompetitif Nasional ( PKM ) Leader: Dewirman Prima Putra Sumber: SIMLITABMAS SOURCE Status: Approved Dana: Rp40.000.000 |
2013 | ||
| 315 | Google Scholar | Authors : IK Budaraga | Pengabdian kepada masyarakat pembuatan ramuan organic tanaman (ROTAN) di kawasan ekonomi masyarakat (KEM) di Kanagarian Tikalak Kecamatan X Koto Singkarak Kabupaten Solok | UNES Journal of Community Service 2 (2), 45-54, 2017 | 0 | 2017 | |
| 316 | Google Scholar | Authors : IK Budaraga | Pengabdian Kepada Masyarakat Pembuatan Ramuan Organik Hama Dikawasan Ekonomi Masyarakat (KEM) Tikalak Kecamatan X Koto Singkarak Kabupaten Solok | 0 | 2017 | ||
| 317 | Google Scholar | Authors : IK Budaraga | PENGABDIAN KEPADA MASYARAKAT PEMBUATAN RAMUAN ORGANIK TANAMAN (ROTAN) DIKAWASAN EKONOMI MASYARAKAT (KEM) KANAGARIAN TIKA... | UNES Journal of Community Service 2 (2), 127-134 | 0 | 2017 | |
| 318 | Google Scholar | Authors : IK Budaraga | PENGABDIAN KEPADA MASYARAKAT PEMBUATAN RAMUAN ORGANIK TANAMAN (ROTAN) DIKAWASAN EKONOMI MASYARAKAT (KEM) KANAGARIAN TIKALAK KECAMATAN X KOTO SINGKARAK KABUPATEN SOLOK | UNES Journal of Community Service 2 (2), 127-134, 2017 | 0 | 2017 | |
| 319 | Google Scholar | Authors : WS Devi | Pengabdian Kepada Masyarakat Penerapan Teori Kaizen untuk Meningkatan Kualitas Usaha Keripik Talas di UKM Asyifa Oleh-Oleh | SEMAR (Jurnal Ilmu Pengetahuan, Teknologi, dan Seni bagi Masyarakat) 12 (1 …, 0 | 1 | 0000 | |
| 320 | Google Scholar | Authors : IK Budaraga, F Maidija | Pengabdian kepada Masyarakat Peningkatan Kualitas Kopi Solok Radjo | Prosiding Seminar Nasional Pengabdian Kepada Masyarakat 1 (1), 181-190, 2021 | 4 | 2021 | |
| 321 | Google Scholar | Authors : IK Budaraga, M Risti, W Sumarno | PENGABDIAN KEPADA MASYARAKAT PENINGKATAN KUALITAS PRODUKSI TAHU DI USAHA TAHU PAKDE IPONG | LOGISTA-Jurnal Ilmiah Pengabdian kepada Masyarakat 6 (1), 2022 | 0 | 2022 | |
| 322 | Google Scholar | Authors : IK Budaraga, M Risti, W Sumarno | Pengabdian Kepada Masyarakat Peningkatan Kualitas Produksi Tahu Di Usaha Tahu Pakde Ipong (Service To The Community Improving The Quality Of Touch Production In Business Tahu … | Logista Jurnal Ilmiah Pengabdian kepada Masyarakat 6 (1), 91-97, 2022 | 0 | 2022 | |
| 323 | Google Scholar | Authors : W Budaraga I Ketut | Pengabdian kepada Masyarakat Peningkatan Kualitas Usaha Keripik Talas Asyifa Oleh-oleh | Seminar Nasional Pengabdian Fakultas Pertanian UNS Tahun 2021 1 (1), 172-180, 2022 | 0 | 2022 | |
| 324 | Google Scholar | Authors : IK Budaraga, W Sri Devi | Pengabdian kepada masyarakat peningkatan kualitas usaha keripik talas Asyifa oleh-oleh | 12 | 2021 | ||
| 325 | Google Scholar | Authors : N Yessirita | PENGARUH FERMENTASI TEPUNG DAUN LAMTORO (Leucaena leucocephala) DENGAN Bacillus laterosporus TERHADAP ENERGI METABOLISME, KECERNA... | Jurnal BiBieT 1 (1), 1-8 | 0 | 2016 | |
| 326 | Google Scholar | Authors : N Yessirita | Pengaruh Fermentasi Tepung Daun Lamtoro (Leucaena Leucocephala) Dengan Bacillus Laterosporus Terhadap Energi Metabolisme, Kecernaan Serat Kasar Dan Retensi Nitrogen Pada Broiler | Jurnal BiBieT 1 (1), 1-8, 2016 | 1 | 2016 | |
| 327 | Google Scholar | Authors : MH Hirzi, I Sidabalok | PENGARUH JUMLAH BAHAN DALAM TANGKI PENYULING METODE UAP DAN AIR TERHADAP RENDEMEN DAN MUTU MINYAK SEREH WANGI (Cymbopogon nardus L. Rendle) | Jurnal Research Ilmu Pertanian 2 (1), 65-78, 2022 | 1 | 2022 | |
| 328 | Google Scholar | Authors : MH Hirzi, I Sidabalok | Pengaruh Jumlah Bahan Dalam Tangki Penyuling Metode Uap dan Air Terhadap Rendemen Serta Mutu Minyak Sereh Wangi (Cymbopogon nardus L. Rendle) | Jurnal Research Ilmu Pertanian 2 (1), 64-77, 2022 | 1 | 2022 | |
| 329 | Google Scholar | Authors : N Yessirita, H Abbas, Y Heryandi, A Dharma | Pengaruh Kapang Trichoderma viride terhadap Kandungan Betakaroten pada Pembiakan beberapa Media Tumbuh Bahan Pakan Unggas | Jurnal Embrio, Universitas Tamansiswa Padang 5 (1), 46-53, 2012 | 0 | 2012 | |
| 330 | Google Scholar | Authors : DA Ramadani, L Hermalena, RA Salihat | Pengaruh Konsentrasi Asam Asetat Terhadap Karakteristik Kolagen dari Sisik Ikan Julung-Julung | Jurnal Research Ilmu Pertanian 4 (2), 186-195, 2024 | 2 | 2024 | |
| 331 | Garuda | Basalius; Inawaty Sidabalok; Nita Yessirita; Leffy Hermalena; Rera Aga Salihat; Eddwina Aidila Fitria | Pengaruh Konsentrasi Asam Asetat Terhadap Karakteristik Kolagen Dari Sisik Ikan Julung-Julung (Hemiramphus SP.) | Jurnal Research Ilmu Pertanian Vol. 5 No. 1 (2025): Jurnal Research Ilmu Pertanian (Februari 2025)15-23 | 4 | 2024 | |
| 332 | Garuda | Yurnalis; Eddwina Aidila Fitria; Irmawan | Pengaruh konsentrasi ekstrak katekin Uncaria gambir terhadap umur simpan ikan teri (Stolephorus sp.) | Journal of Scientech Research and Development Vol 5 No 1 (2023): JSRD, June 2023256-266 | 6 | 2021 | |
| 333 | Google Scholar | Authors : YMS Asnurita, IK Budaraga | Pengaruh konsentrasi starter Acetobacter xylinum terhadap mutu nata de cucumber | Jurnal pertanian UMSB 1 (2), 2017 | 6 | 2017 | |
| 334 | Google Scholar | Authors : D Rahmadhan, L Hermalena | Pengaruh Lama Pengeringan Buah Lindur (Bruguiera Ghymnorrhiza L.) Terhadap Mut Tepung | Jurnal Research Ilmu Pertanian 1 (2), 91-99, 2021 | 3 | 2021 | |
| 335 | Google Scholar | Authors : RA Salihat | PENGARUH MODIFIKASI SEL FOTOVOLTAIK TERHADAP KINERJANYA DALAM MENGHASILKAN ARUS DAN TEGANGAN DENGAN SISTEM LARUTAN ELEKTROLIT KI/KI3 | UPT. Perpustakaan Unand, 2015 | 0 | 2015 | |
| 336 | Google Scholar | Authors : IK Budaraga | Pengaruh Pemanenan dan Penanganan Terhadap Gizi Pangan | Hei Publishing Indonesia, 2023 | 0 | 2023 | |
| 337 | Google Scholar | Authors : gusriati I Ketut Budaraga | Pengaruh Pemberian Berbagai Konsentrasi Asap Cair Tempurung Kelapa Terhadap Mutu Pengolahan Ikan Teri dalam Rangka Peningkatan Kualitas Hasil Perikan... | SIGMATEK (Jurnal Sains dan Teknologi) 256 (Vol.2 N.2 Sept.2008 ISSN 1978 … | 0 | 2008 | |
| 338 | Google Scholar | Authors : gusriati I Ketut Budaraga | Pengaruh Pemberian Berbagai Konsentrasi Asap Cair Tempurung Kelapa Terhadap Mutu Pengolahan Ikan Teri dalam Rangka Peningkatan Kualitas Hasil Perikanan di Kabupaten Pesisir Selatan | SIGMATEK (Jurnal Sains dan Teknologi) 256 (Vol.2 N.2 Sept.2008 ISSN 1978 …, 2008 | 0 | 2008 | |
| 339 | Google Scholar | Authors : T Astina, A Asnurita, IK Budaraga | Pengaruh Penambahan Ekstrak Gambir (Uncaria Gambir Roxb.) Sebagai Antibakteri Pada Pembuatan Sabun Padat Buram | Jurnal Teknologi Pertanian Andalas 26 (2), 142-150, 2022 | 0 | 2022 | |
| 340 | Garuda | I Ketut Budaraga; Eddwina Aidila Fitria | PENGARUH PENAMBAHAN EKSTRAK GAMBIR (Uncaria gambir Roxb.) SEBAGAI ANTIBAKTERI PADA PEMBUATAN SABUN PADAT OPAQUE | Dinamisia : Jurnal Pengabdian Kepada Masyarakat Vol. 7 No. 4 (2023): Dinamisia: Jurnal Pengabdian Kepada Masyarakat1184-1189 | 3 | 2022 | |
| 341 | Google Scholar | Authors : EA Fitria | Pengaruh Penambahan Gula Aren Terhadap Karakteristik Selai Lembaran Wortel (Daucus carota. L) Cita Rasa Jahe | Journal of Scientech Research and Development 5 (1), 256-266, 2023 | 1 | 2023 | |
| 342 | Garuda | Basalius; Inawaty Sidabalok; Nita Yessirita; Leffy Hermalena; Rera Aga Salihat; Eddwina Aidila Fitria | PENGARUH PENAMBAHAN GULA AREN TERHADAP KARAKTERISTIK SELAI LEMBARAN WORTEL (Daucus carota.L) CITA RASA JAHE | Jurnal Research Ilmu Pertanian Vol. 5 No. 1 (2025): Jurnal Research Ilmu Pertanian (Februari 2025)15-23 | 4 | 2023 | |
| 343 | Google Scholar | Authors : IM Putra Bungsu, IK Budaraga, N Yessirita | Pengaruh penambahan serbuk jahe merah (Zingiber officinale Var. rubrum) terhadap teh hasil kempaan daun gambir (Uncaria gambir Roxb) | Jurnal Research Ilmu Pertanian (JRIP) 2 (1), 120-129, 2021 | 5 | 2021 | |
| 344 | Google Scholar | Authors : S Syamsuwirman, IK Budaraga, T Tukiran | PENGARUH PENGGUNAAN ASAP CAIR TERHADAP SERANGAN PENYAKIT BUSUK DAUN (Phytophthora infestans) PADA KENTANG (Solanum tuberasum L.) | UNES Journal of Scientech Research 2 (2), 218-228, 2017 | 0 | 2017 | |
| 345 | Google Scholar | Authors : RA Salihat, DP Putra | PENGARUH SUBSTITUSI TEPUNG TERIGU DENGAN TEPUNG BERAS UNGU TERHADAP MUTU DAN AKTIVITAS ANTIOKSIDAN BROWNIES KUKUS | Jurnal Teknologi Pangan 15 (2), 26-38, 2021 | 11 | 2021 | |
| 346 | Google Scholar | Authors : N Yessirita, Z Suhaemi, Sunadi | Pengaruh Suplementasi Metionin-Lisin Tepung Daun Lamtoro Fermentasi Terhadap Retensi N dan Energi Metabolisme Ayam Broiler | Prosiding Webinar Nasional " Starategi Pengembangan Industri Perunggasan …, 2021 | 0 | 2021 | |
| 347 | Google Scholar | Authors : Sunadi, W H, N Yessirita | Pengaruh Waktu Prunning Anakan dan Dosis Pupuk Kandang pada Pertumbuhan dan Hasil Padi Sawah (Oryza sativa) dalam metode SRI | Prosiding Seminar Lokakarya Nasional 5 (PAGI 2019), 86-90, 2019 | 0 | 2019 | |
| 348 | Google Scholar | Authors : CL Suryani, AP Kamarudin, IK Budaraga, N Suhartatik, E Julianti, U Pato, ... | PENGEMBANGAN PANGAN FUNGSIONAL | 0 | 0000 | ||
| 349 | Penelitian | Inawaty Sidabalok; Herman | PENGEMBANGAN UBIKAYU BERPOTENSI TINGGI DI LAHAN MARGINAL UNTUK MENGHASILKAN BIOETHANOL SEBAGAI SUMBER ENERGI TERBARUKAN |
Penelitian Kompetitif Nasional ( PSN Institusi ) Leader: Hanafi Sumber: BIMA SOURCE Status: Approved Dana: Rp65.000.000 |
2018 | ||
| 350 | Google Scholar | Authors : IK Budaraga | Pengenalan Sistem Penerapan Pertanian Organik Pada Masyarakat | Buletin Ilmiah Ekasakti 21 (2), 1-14, 2011 | 0 | 2011 | |
| 351 | Google Scholar | Authors : IK Budaraga | Pengenalan Sistem Pertanian Organik kepada Masyarakat | Ekasakti 125 (Vol 21.N0.2 Agustus 2011 ISSN 0854-8099), 1-14, 2011 | 0 | 2011 | |
| 352 | Google Scholar | Authors : N Yessirita | Penggunaan Azolla (Azolla pinnata Brown) Dalam Ransum Ternak Itik Periode Pertumbuhan | Jurnal Embrio, Universitas Tamansiswa Padang 1 (1), 35-39, 2008 | 0 | 2008 | |
| 353 | Google Scholar | Authors : E Susanto, I Sidabalok, E Dewantoro | Penggunaan ekstrak lengkuas (Alpinia galanga) untuk pengobatan ikan gurami (Osphronemus gouramy) yang diinfeksi jamur Saprolegnia sp | Jurnal Ruaya: Jurnal Penelitian dan Kajian Ilmu Perikanan dan Kelautan 4 (2), 2020 | 5 | 2020 | |
| 354 | Google Scholar | Authors : HG Leffy Hermalena, S.Pi., M.Si, Henny Puspita Sari, S.P., M.P | PENGINGKATAN HASIL PRODUKSI BUDIDAYA IKAN LELE DENGAN TEKNOLOGI PENGEMBANGAN PROBIOTIK DAN HASIL OLAHAN IKAN LELE DI KWT MAKMUR BERSAMA | Surat Pencatatan Ciptaan, 2022 | 0 | 2022 | |
| 355 | Google Scholar | Authors : IK Budaraga | Pengkajian respirasi buah mangga dan salak terolah minimal selama penyimpanan | IPB (Bogor Agricultural University), 1998 | 3 | 1998 | |
| 356 | Google Scholar | Authors : IK Budaraga | Pengolahan Biogas | Hei Publishing Indonesia, 2024 | 0 | 2024 | |
| 357 | Google Scholar | Authors : IK Budaraga | Pengolahan Limbah Tapioka Menjadi Biogas (Energi Alternatif) | Jurnal Ekotrans Jurnal Pemikiran dan Analisis masalah Ekologi dan …, 2009 | 0 | 2009 | |
| 358 | IPRs | Leffy Hermalena, S.Pi., M.Si., Novi Yanti, S.E., M.Si., Herda Gusvita, S.P., M.Si., Dr. Ir. Nita Yessirita, M.P., Dr. Ir. Murnita, M.P., Ir. Inawaty Sidabalok, M.Si. Dr. Ir. Murnita, M.P. | Pengolahan Rambut Jagung untuk Teh Herbal dan Strategi Pemasaran | EC00202455228 | 2024 | ||
| 359 | Google Scholar | Authors : L Hermalena, H Gusvita, N Yessirita, B Badal, RA Salihat, RA Syukra, ... | Pengolahan Rambut Jagung Untuk Teh Herbal Dan Strategi Pemasarannya | Ekasakti Jurnal Penelitian dan Pengabdian 5 (1), 90-97, 2024 | 1 | 2024 | |
| 360 | Google Scholar | Authors : EA Fitria, IK Budaraga, S Zebua | Pengujian Asam Lemak Bebas Pada Wajik Yang Dilapisi Edible Film Khitosan-PVA | SAGU Journal–Agri. Sci. Tech 22 (1), 38-42, 2022 | 1 | 2022 | |
| 361 | Google Scholar | Authors : E Aidila Fitria, I Ketut Budaraga, S Zebua | Pengujian Asam Lemak Bebas Pada Wajik Yang Dilapisi Edible Film Khitosan-Pva Testing of Free Fatty Acids on a Wajik Coated Edible Film Khitosan-Pva | SAGU Journal: Agricultural Science and Technology 21 (1), 38-42, 2022 | 3 | 2022 | |
| 362 | Google Scholar | Authors : RA Salihat, DP Putra | PENGUJIAN MUTU DAN AKTIVITAS ANTIOKSIDAN BROWNIES PANGGANG DARI SUBSTITUSI TEPUNG TERIGU DENGAN TEPUNG BERAS UNGU | Jurnal Sains dan Teknologi Pangan 6 (2), 3817-3830, 2021 | 9 | 2021 | |
| 363 | Google Scholar | Authors : I Sidabalok | Pengujian Mutu Dan Efektivitas Beberapa Jenis Pupuk Alternatif Di Sulawesi Selatan | 0 | 0000 | ||
| 364 | Google Scholar | Authors : L Hermalena, HP Sari, H Gusvita, N Yessirita, S Syamsuwirman, SK Sari | PENINGKATAN HASIL PRODUKSI BUDIDAYA IKAN LELE DENGAN TEKNOLOGI PENGEMBANGAN PAKAN PROBIOTIK DI KELOMPOK WANITA TANI MAKMUR BERSAMA | Martabe: Jurnal Pengabdian Kepada Masyarakat 5 (10), 3486-3492, 2022 | 0 | 2022 | |
| 365 | IPRs | Dr.Ir.Nita Yessirita, MP | Peningkatan Kualitas dan detoksifikasi mimosin tepung daun lamtoro (leucaena leucochepala) yang difermentasi dengan Baillus sp dab Trichodema viride serta pengaruhnya pada produktivitas dan dan kualitas telur itik Pitalah | EC00201811348 | 2018 | ||
| 366 | Google Scholar | Authors : Y NITA | PENINGKATAN KUALITAS GIZI DAN DETOKSIFIKASI MIMOSIN TEPUNG DAUN LAMTORO (Leucaena leucocephala) YANG DIFERMENTASI DENGAN Bacillus Sp DAN Trichoderma viride SERTA PENGARUHNYA … | Universitas Andalas | 0 | 2014 | |
| 367 | Google Scholar | Authors : N Yessirita, MH Abbas, Y Heryandi, A Dharma | Peningkatan Kualitas Telur Itik Pitalah dengan Pemberian Pakan Tepung Daun Lamtoro (Leucaena leucochepala) yang Difermentasi dengan Bacillus laterosporus dan Trichoderma viride | Jurnal Peternakan Indonesia (Indonesian Journal of Animal Science) 17 (1), 54-62, 2015 | 11 | 2015 | |
| 368 | Google Scholar | Authors : N Yessirita, MH Abbas, Y Heryandi, A Dharma | Peningkatan Kualitas Telur Itik Pitalah dengan Pemberian Pakan Tepung Daun Lamtoro (Leucaena leucochepala) yang Difermentasi dengan Bacillus laterosporus... | Jurnal Peternakan Indonesia (Indonesian Journal of Animal Science) 17 (1), 54-62 | 0 | 2015 | |
| 369 | Pengabdian | Asnurita | PENINGKATAN PENDAPATAN MASYARAKAT MELALUI PEMANFAATAN ASAP CAIR, BRIKET TEMPURUNG KELAPA DAN KOMPOR BRIKET SEBAGAI ENERGI ALTERNATIF PENGGANTI MINYAK TANAH DI NAGARI KETAPING KECAMATAN BATANG ANAI KABUPATEN PADANG PARIAMAN PROVINSI SUMATERA BARAT |
Pengabdian Kepada Masyarakat Kompetitif Nasional ( KKN-PPM ) Leader: Yurnalis Sumber: SIMLITABMAS SOURCE Status: Approved Dana: Rp65.000.000 |
2014 | ||
| 370 | Google Scholar | Authors : Yurnalis | Peningkatan Pendapatan Masyarakat Melalui Pemanfaatan Asap Cair, Briket Tempurung Kelapa dan Kompor Briket di Nagari Kataping | Menara Ilmu 56 (Volume IX Jilid 1 No.56), 180-186, 2015 | 0 | 2015 | |
| 371 | Google Scholar | Authors : IK Budaraga | Peningkatan Pendapatan Masyarakat Melalui Pemanfaatan Briket Tempurung Kelapa, Kompor Briket Dan Asap Cair Di Desa Sungai Rambai Kecamatan Pariaman Utara Kota Pariaman Provinsi … | Jurnal Penelitian dan Kajian Ilmiah Menara Ilmu 8 (52), 30-35, 2014 | 0 | 2014 | |
| 372 | Pengabdian | I Ketut Budaraga | PENINGKATAN PENDAPATAN MASYARAKAT MELALUI PEMANFAATAN BRIKET TEMPURUNG KELAPA,KOMPOR BRIKET DAN ASAP CAIR DI DESA SUNGAI RAMBAI KECAMATAN PARIAMAN UTARA KOTA PARIAMAN PROVINSI SUMATERA BARAT |
Pengabdian Kepada Masyarakat Kompetitif Nasional ( KKN-PPM ) Leader: Risal Abu Sumber: SIMLITABMAS SOURCE Status: Approved Dana: Rp60.000.000 |
2014 | ||
| 373 | Google Scholar | Authors : RA I Ketut Budaraga | Peningkatan Pendapatan Masyarakat Melalui Pemanfaatan Briket Tempurung Kelapa,Kompor Briket dan Asap Cair Di Desa Sungai Rambai Kecamatan Pariaman Utara Kota PAriaman | Menara ilmu 121 (Vol VIII No.52 Sept 2014 ISSN 1693-2617), 35-49, 2014 | 0 | 2014 | |
| 374 | Google Scholar | Authors : RA I Ketut Budaraga | Peningkatan Pendapatan Masyarakat Melalui Pemanfaatan Briket Tempurung Kelapa,Kompor Briket dan Asap Cair Di Desa Sungai Rambai Kecamatan Pariaman... | Menara ilmu 121 (Vol VIII No.52 Sept 2014 ISSN 1693-2617), 35-49 | 0 | 2014 | |
| 375 | Pengabdian | I Ketut Budaraga | PENINGKATAN PRODUKSI TANAMAN KAKAO MELALAUI PEMANFAATAN ASAP CAIR TEMPURUNG KELAPA DAN PUPUK ORGANIK DI NAGARI SUNGAI BULUH KECAMATAN BATANG ANAI KABUPATEN PADANG PARIAMAN PROVINSI SUMATERA BARAT |
Pengabdian Kepada Masyarakat Kompetitif Nasional ( KKN-PPM ) Leader: Gusriati Sumber: BIMA SOURCE Status: Approved Dana: Rp60.000.000 |
2013 | ||
| 376 | Google Scholar | Authors : Yurnalis | Peningkatan Umur Simpan Mie Basah Menggunakan Tepung Kunyit | EKOTRANS 10 (2 Juli 2010), 89-97, 2010 | 0 | 2010 | |
| 377 | Google Scholar | Authors : IK Budaraga, R Ramaiyulis, E Nurdin, R Rauf | Penyuluhan Jajanan, Makanan dan Kantin Sehat di Sekolah SMA 2 Batang Anai Kecamatan Batang Anai Kabupaten Padang Pariaman | Buletin Udayana Mengabdi 18 (3), 61-67, 2019 | 11 | 2019 | |
| 378 | Google Scholar | Authors : IK Budaraga | Penyuluhan Manfaat Penerapan Pertanian Organik Di Kelompok Tani Kampung Apar Nagari Se Buluh Kecamatan Batang Anai Kabupaten Padang Pariaman | 1 | 2019 | ||
| 379 | Google Scholar | Authors : IK Budaraga | Penyuluhan Pemanfaatan Asap Cair Kulit Kakao Sebagai Pestisida Alami Pada Tanaman Kakao Di Kelompok Tani Aulia Natural Di Kabupaten Padang Pariaman | 0 | 2017 | ||
| 380 | Google Scholar | Authors : IK Budaraga | Peranan Rumput Laut Dalam Formulasi Pengembangan Produk Pangan Fungsional | Hei Publishing Indonesia, 2024 | 0 | 2024 | |
| 381 | Buku | Nurhayati, I Ketut Budaraga, Nurul Fajrih H., Soraya Kusuma Putri, Juni Sumarmono, Rahmaniar, Rifda Naufalin, Santi Dwi Astuti, Sri Widowati | PERANAN TEKNOLOGI PENGOLAHAN DAN PENGAWETAN PANGAN BERBASIS SUMBER DAYA DAN KEARIFAN LOKAL UNTUK MEWUJUDKAN PANGAN SEHAT | CV HEI Publishing | 2024 | ||
| 382 | Google Scholar | Authors : IK Budaraga | Peranan Teknologi Pengolahan Dan Pengawetan Pangan Berbasis Sumber Daya Dan Kearifan Lokal Untuk Mewujudkan Pangan Sehat | Hei Publishing Indonesia, 2024 | 0 | 2024 | |
| 383 | Google Scholar | Authors : N Yessirita, Yulidas | Perbaikan produksi ternak sapi melalui deteksi kebuntingan dini menggunakan Ammonium Molibdat Tetrahidrat. Jurnal Iptek Terapan. | Jurnal Ipteks Terapan Kopertis X Padang 5 (1), 44-53, 2011 | 0 | 2011 | |
| 384 | Google Scholar | Authors : M Sentia, I Sidabalok, L Hermalena | perbandingan ikan tandeman (Rastrelliger sp.) dengan ampas tahu pada pembuatan abon ikan | UNES JOURNAL MAHASISWA PERTANIAN 5 (2), 078-091, 2021 | 1 | 2021 | |
| 385 | Google Scholar | Authors : Z Suhaemi, Febriani, Sabrina, N Yessirita | Perbandingan Produksi dan Nilai Ekonomis Plasma Nutfah Itik lokal Sumatera Barat dalam Upaya Konservasi | Prosiding Seminar Nasional Peternakan Berkelanjutan ke-10, Fapet Unpaj 1 …, 2020 | 0 | 2020 | |
| 386 | Google Scholar | Authors : Z Suhaemi, S Sabrina, F Febriani, N Yessirita | Perbandingan Produksi dan Nilai Ekonomis Plasma Nutfah Itik Lokal Sumatera Barat dalam Upaya Konservasi Comparison Study of Production and Economic Value Germplasm of West … | Prosiding Seminar Nasional Peternakan Berkelanjutan ke-10 Fapet Unpad … | 0 | 0000 | |
| 387 | Pengabdian | Yurnalis | PERBANYAKAN KOLONI LEBAH MADU (Apis cerana Fabr.) DAN PEMBERIAN MAKANAN TAMBAHAN UNTUK PENINGKATAN PRODUKSI MADU PADA PUSAT PERLEBAHAN KABUPATEN PADANG PARIAMAN |
Pengabdian Kepada Masyarakat Kompetitif Nasional ( PKM ) Leader: Dewirman Prima Putra Sumber: SIMLITABMAS SOURCE Status: Approved Dana: Rp37.500.000 |
2016 | ||
| 388 | Google Scholar | Authors : nursal idris I Ketut Budaraga,Darmansyah, abdul razal | Percepatan difusi dan pemanfaatan iptek penerapan bioteknologi NT 45 di Bidang Budidaya Perikanan pada Kolam Pendederan Terhadap Pertumbuhan Bibit Ikan Nila | aquaculture 2008 Indonesia Partnership and Inovation for Sustanainable …, 2008 | 0 | 2008 | |
| 389 | Google Scholar | Authors : nursal idris I Ketut Budaraga,Darmansyah, abdul razal | Percepatan difusi dan pemanfaatan iptek penerapan bioteknologi NT 45 di Bidang Budidaya Perikanan pada Kolam Pendederan Terhadap Pertumbuhan Bibit Ikan... | aquaculture 2008 Indonesia Partnership and Inovation for Sustanainable … | 0 | 2008 | |
| 390 | Google Scholar | Authors : IK Budaraga | Percepatan Difusi dan Pemanfaatan Iptek Penerapan Inovasi Bioteknologi NT 45 dalam Penglolaan Tambak Air Payau Untuk peningkatan Pendapatan Masyarakat di Daerah Pesisir | Ekontrans 186 (Vol.10 No.2 Juli 2010 ISSN 1411-4615), 164-176, 2010 | 0 | 2010 | |
| 391 | Google Scholar | Authors : IK Budaraga | Percepatan Difusi dan Pemanfaatan Iptek Penerapan Inovasi Bioteknologi NT 45 dalam Penglolaan Tambak Air Payau Untuk peningkatan Pendapatan Masyarakat... | Ekontrans 186 (Vol.10 No.2 Juli 2010 ISSN 1411-4615), 164-176 | 0 | 2010 | |
| 392 | Google Scholar | Authors : IK Budaraga | Percepatan Difusi dan Pemanfaatan iptek Pengolahan Tempurung kelapa Menjadi Briket Sebagai Alternatif Pengganti BBM di Kota Pariaman Provinsi Sumatera Ba... | Ekotrans 186 (Vol.10 No.2 Juli 2010 ISSN 1411-4615), 71-87 | 0 | 2010 | |
| 393 | Google Scholar | Authors : IK Budaraga | Percepatan Difusi dan Pemanfaatan Iptek Pengolahan Tempurung Kelapa Menjadi Briket sebagai Alternatif Pengganti BBM di Kota Pariaman Provinsi Sumatera Barat | Jurnal Ekotrans Jurnal Pemikiran dan Analisis masalah Ekologi dan …, 2010 | 0 | 2010 | |
| 394 | Google Scholar | Authors : J SEBASTIAN PUTRA PERDANA LODYA, D PUTRA, D PUSPITA DEWI | PERENCANAAN STRATEGI SISTEM DAN TEKNOLOGI INFORMASI PADA PT. ANGKASA BUANA CIPTA DENGAN MENGGUNAKAN METODE PENDEKATAN ENTERPRISE ARCHITECTURE | BINUS, 2012 | 0 | 2012 | |
| 395 | Google Scholar | Authors : IK Budaraga | Performance Characteristics Of Cocoa Skin Liquid Smokersin Different Water Content Conditions | inter 10 (15), 2001 | 0 | 2001 | |
| 396 | Google Scholar | Authors : I Ayesha, M Yurnalis, M Mukhnizar | Perilaku Pengrajin Gula Merah Tebu Tradisional di Nagari Bukik Batabuah, Kecamatan Canduang, Kabupaten Agam | Jurnal Pembangunan Nagari 1 (2), 89-102, 2016 | 13 | 2016 | |
| 397 | Penelitian | Yurnalis; Gusriati | Persepsi dan Partisipasi Petani terhadap Pertanian Organik di Kecamatan Baso Kabupaten Agam |
Penelitian Desentralisasi ( PDUPT ) Leader: Amnilis Sumber: SIMLITABMAS SOURCE Status: Approved Dana: Rp45.000.000 |
2013 | ||
| 398 | Google Scholar | Authors : HB Jumin, MN M Nur, W Warnita, H Hapsoh, S Ulpah, M Mardaleni, ... | Pertanian Berkelanjutan | UIR PRESS, 2024 | 1 | 2024 | |
| 399 | Google Scholar | Authors : NL Kartini, IK Budaraga | Pertanian Organik Penyelamat Kehidupan | Deepublish, 2020 | 7 | 2020 | |
| 400 | Google Scholar | Authors : IKB Ni Luh Kartini | Pertanian Terpadu Organik Sistem SabicaITaLA mendukung Ekonomi Berkelanjutan | 0 | 2022 | ||
| 401 | Pengabdian | Yonny Arita Taher; Nita Yessirita | PKM KELOMPOK TANI BINA KARYA |
Pengabdian Kepada Masyarakat Kompetitif Nasional ( PKM ) Leader: Murnita Sumber: BIMA SOURCE Status: Approved Dana: Rp48.300.000 |
2019 | ||
| 402 | Google Scholar | Authors : HP Sari, L Hermalena | Pkm Peningkatan Produksi Padi Dengan Penerapanteknologi Jajar Legowo Tipe 2: 1di Pariaman Selatan, Kota Pariaman | Abdimas Journal Of Mai Wandeu 1 (1), 16-22, 2021 | 1 | 2021 | |
| 403 | Google Scholar | Authors : DP Putra, RA Salihat, Y Desi | PKM Usaha Produksi Jamur Tiram dan Olahannya Di Nagari Bisati Sungai Sariak Kecamatan VII Koto Kabupaten Padang Pariaman | LOGISTA-Jurnal Ilmiah Pengabdian kepada Masyarakat 5 (1), 153-160, 2021 | 3 | 2021 | |
| 404 | Garuda | Fiana, Risa Meutia; Febjislami, Shalati; Dewi Hayati, PK; Pramana Putra, Dian; Kurniadi, Deri | PKM USAHA PRODUKSI JAMUR TIRAM DANOLAHANNYA DI NAGARI BISATI SUNGAI SARIAK KECAMATAN VII KOTO KABUPATEN PADANG PARIAMAN | Andalasian International Journal of Social and Entrepreneurial Development Vol. 4 No. 01 (2024): Andalasian International Journal of Social and Entrepreneurial Development23-26 | Accred : Unknown | 2021 | |
| 405 | Penelitian | - | Potensi Bacillus laterosporus dan kapang Trichoderma viride Pada Fermentasi Tepung Daun Lamtoro (Leucaena leucocephala) dalam Upaya Detoksifikasinya Mimosinnya secara Biologi dan Pengaruhnya terhadap Produktivitas itik Pitalah |
Penelitian Kompetitif Nasional ( PPS-PDD ) Leader: Nita Yessirita Sumber: BIMA SOURCE Status: Approved Dana: Rp42.500.000 |
2013 | ||
| 406 | Google Scholar | Authors : A Mardiah, EA Fitria | Potensi Ikan Asap untuk Meningkatkan Kesejahteraan Petani Ikan The Potential of Smoked Fish to Improve the Welfare of Fish Farmers | 0 | 0000 | ||
| 407 | Google Scholar | Authors : IK Budaraga | Potensi Pemanfaatan Asap Cair Sebagai Pengawet Bahan Pangan | Jurnal Ekotrans: Jurnal Pemikiran Dan Analisis Masalah Ekologi Dan …, 2011 | 1 | 2011 | |
| 408 | Google Scholar | Authors : IK Budaraga | Potensi pemanfaatan Tempurung Sawit sebagai Bahan Baku Pembuatan Briket,Arang Aktif,Fenol dan Asap Cair | Ekotrans 183 (Vol 9 No.2 Juli 2009), 56-65, 2009 | 0 | 2009 | |
| 409 | Google Scholar | Authors : IK Budaraga | Potensi Tempurung Sawit Sebagai Bahan Baku Pembuatan Briket, Arang Aktif, Fenol Dan Asap Cair | Buletin Ilmiah Ekasakti 16 (1), 78-93, 2009 | 0 | 2009 | |
| 410 | Google Scholar | Authors : IK Budaraga | Potensi, Permasalahan, Tantangan Dan Strategi Pembangunan Pertanian Ke Depan | Jurnal Ekotrans 12 (2), 1-17, 2012 | 0 | 2012 | |
| 411 | Scopus | Creator : Ramaiyulis D.S. | Potential and development of incubation technology to improve the quality of "dadih" as a specific food of minangkabau | Livestock Research for Rural Development | 0 | Q3 as Journal | 2021 |
| 412 | Google Scholar | Authors : IK Budaraga, R Ramaiyulis, D Syukriani, N Nilawati, E Yulia | Potential and development of incubation technology to improve the quality of" dadih" as a specific food of minangkabau | Livestock Research for Rural Development 33 (7) 2021 33 (7), 2021 | 1 | 2021 | |
| 413 | Google Scholar | Authors : D Syukriani, Ramaiyulis, Nilawati, E Yulia, IK Budaraga | Potential and development of incubation technology to improve the quality of" dadih" as a specific food of minangkabau. | 0 | 2021 | ||
| 414 | Google Scholar | Authors : LO Nelwan, U Ahmad, R Hasbullah, IW Astika | Proceedings of AESAP 2016 The 1 st International Conference on the Role of Agricultural Engineering for Sustainable Agriculture Production | 0 | 0000 | ||
| 415 | Google Scholar | Authors : IK Budaraga | Processing taro tubers (Colocasia esculenta (L) Schott) become flour as efforts to increase community revenues in mentawai region | Journal of Life Sciences Research 5 (2), 62-70, 2017 | 3 | 2017 | |
| 416 | Google Scholar | Authors : R Rini, K Sayuti, F Azima, EA Fitria | Production and Distribution of eucalyptus flavored hand sanitizers to the public society during new normal in Padang City, West Sumatera Province: A community Service Report | Andalasian International Journal of Information Technology for Livelihood 1 …, 2021 | 0 | 2021 | |
| 417 | Google Scholar | Authors : Z Suhaemi, S Sabrina, N Yessirita, N Fati, F Febriani, B Malik | Production potential of the first generation of selected Pitalah and Bayang ducks as a community economic resource in West Sumatra | Journal of Advanced Veterinary and Animal Research 10 (3), 378, 2023 | 0 | 2023 | |
| 418 | Google Scholar | Authors : H Gusvita, DS Chairani, I Sidabalok, YA Taher, Y Oktisia | Productivity Optimization of Rainfed Rice Land in Nagari Pungasan Utara, Regency of Pesisir Selatan through Determinant Factor Analysis | TEC EMPRESARIAL 18 (1), 404-414, 2023 | 0 | 2023 | |
| 419 | IPRs | Dr. Ir. Zasmeli Suhaemi, MP, Dr. Ir.. Sabrina, MP, Dr. Ir. Nita Yessirita, MP, Febriani, SE., M.Si | Produksi Itik Lokal Unggul Sumatera Barat Melalui Seleksi dan Pemurnian Galur (Keragaman Genetik Rendah) serta Karakterisasi Potensi Hasil Persilangan Guna Peningkatan Sumber Daya Ekonomi Masyarakat | EC00201902452 | 2019 | ||
| 420 | Penelitian | Febriani; Sabrina; Nita Yessirita | Produksi Itik Lokal Unggul Sumatera Barat Melalui Seleksi dan Pemurnian Plasma Nutfah (Keragaman Genetik Rendah) serta Karakterisasi Potensi Hasil Persilangan Guna Peningkatan Sumber Daya Ekonomi Masyarakat |
Penelitian Kompetitif Nasional ( PT ) Leader: Zasmeli Suhaemi Sumber: BIMA SOURCE Status: Approved Dana: Rp110.153.000 |
2020 | ||
| 421 | Google Scholar | Authors : Z Suhaemi, S Sabrina, F Febriani, N Yessirita | Produksi Itik Lokal Unggul Sumatera Barat Melalui Seleksi dan Pemurnian Galur (Keragaman Genetik Rendah) serta Karakterisasi Potensi Hasil Persilangan Guna Peningkatan Sumber … | 0 | 2019 | ||
| 422 | Google Scholar | Authors : D Sartika, A Firmanda, IW Arnata, F Fahma, DA Rusmawati, S Robbani, ... | Progress and roles of lignosulfonates in food active packaging design: A review | International Journal of Biological Macromolecules, 146859, 2025 | 0 | 2025 | |
| 423 | Google Scholar | Authors : IK Budaraga | Proses Pembuatan Asap Cair Dengan Sistem Vakum | 0 | 2022 | ||
| 424 | Google Scholar | Authors : IK Budaraga | Prospek Tepung Sukun Untuk Berbagai Produk Makanan Olahan Dalam Upaya Menunjang Diversifikasi Pangan | Jurnal Ekotrans: Jurnal Pemikiran Dan Analisis Masalah Ekologi Dan …, 2008 | 0 | 2008 | |
| 425 | Google Scholar | Authors : C Wulandari, IK Budaraga, W Wellyalina, N Liamnimitr | Proximate test and organoleptic test on the characteristics of the moringa layer CAKE | Andalasian International Journal of Agriculture and Natural Sciences (AIJANS …, 2020 | 5 | 2020 | |
| 426 | Google Scholar | Authors : C Wulandari, IK Budaraga, W Williyana, L Napassawan | Proximate Test and Organoleptik Test on The Characteristics of the moringa Layer Cake | Andalasian International Journal of Agricultural and Natural Sciences 1 (01 …, 2020 | 4 | 2020 | |
| 427 | Google Scholar | Authors : IK Budaraga, V Saibuma, L Hermalena | Quality of red tuna (Yellowfin tuna) fishball, white oyster mushroom (Pleurotus ostreatus) on different types of packaging and storage time | IOP Conference Series: Earth and Environmental Science 715 (1), 012068, 2021 | 8 | 2021 | |
| 428 | Google Scholar | Authors : H Jantiko, IBK Suardana, KTP Gelgel | Quick jump to page content | 0 | 0000 | ||
| 429 | Google Scholar | Authors : IK Budaraga, R Abu | Rancang bangun alat pengering hasil perikanan menggunakan kompor briket tempurung kelapa | Laporan Penelitian Lembaga Penelitian dan Pengabdian Kepada Masyarakat …, 2014 | 5 | 2014 | |
| 430 | Buku | Nurhayati, Chatarina Lilis Suryani, Anna Permatasari Kamarudin, Rohadi, I Ketut Budaraga, Pahman Habibi [dan 7 lainnya] ; editor, Nur Ahmad Habibi, S.Gz., M.P., : Muslimah, S.Tr.Kes., | Rekayasa Bioenergi | Hei Publishing Indonesia | 2024 | ||
| 431 | Penelitian | Zasmeli Suhaemi; Yurnalis | Rekayasa Telur itik Pitalah Berkualitas dengan Suplementasi Metionin Lisin untuk Pemberdayaan Ekonomi Masyarakat |
Penelitian Kompetitif Nasional ( PT ) Leader: Nita Yessirita Sumber: BIMA SOURCE Status: Approved Dana: Rp108.000.000 |
2019 | ||
| 432 | Google Scholar | Authors : IK Budaraga | Rice Intelligent From Making Mocaf (Modified Cassava Flour) | Universitas Ekasakti Padang (International Conference on Global Education V …, 2017 | 0 | 2017 | |
| 433 | Google Scholar | Authors : R Khathir, R Agustina, D Nurba | Shelf-life estimation of cauliflower based on total soluble solids by using the Arrhenius and Q10 approach | IOP Conference Series: Earth and Environmental Science 365 (1), 1755-1315, 2019 | 4 | 2019 | |
| 434 | Google Scholar | Authors : IK Budaraga | Sifat Fungsional Asam LEmak Trans | Hei Publishing Indonesia, 2024 | 0 | 2024 | |
| 435 | Google Scholar | Authors : IK Budaraga | Skripsi Pengaruh Blanching dan Pemberian Natrium Metabisulfit Terhadap Beberapa komponen Mutu Tepung Pisang Kepok (musa parasidiaca) | Universitas Mataram, 1992 | 0 | 1992 | |
| 436 | Google Scholar | Authors : IK Budaraga, S Susilawati | Sosialisasi Kepada Masyarakat Peningkatan Kualitas Olahan Ikan Maco Di Ukm “Rodi Maco” | Seminar nasional pengabdian kepada masyarakat (SNPKM), 1-5, 2021 | 0 | 2021 | |
| 437 | Google Scholar | Authors : D Prima Putra, D Dahelmi, S Salmah, E Swasti | Species Diversity of Stingless Bees (Hymenoptera: Meliponini) in Chili PEPPER (Capsicum annum L.) Plantation in West Sumatera | International Journal of Science and Research (IJSR) 5 (4), 1527-1532, 2016 | 0 | 2016 | |
| 438 | Google Scholar | Authors : EA Fitria | Stabilitas Ekstrak Klorofil Berbagai Jenis Daun Tanaman Sebagai Pewarna Label Indikator | UNES JOURNAL OF AGRICULTURAL SCIENTIES 2 (2), 114-124, 2018 | 4 | 2018 | |
| 439 | Google Scholar | Authors : DP Putra, Novelina, A Asben | Stability and toxicity test of angkak pigment powder from sago hampas -rice flour substrate as natural dyes | Journal of Applied Agricultural Science and Technology 5 (1), 38-49, 2021 | 3 | 2021 | |
| 440 | Google Scholar | Authors : AA Dian Pramana Putra, Novelina | STABILITY AND TOXICITY TEST OF ANGKAK PIGMENT POWDER FROM SAGO HAMPAS- RICE FLOUR SUBSTRATE AS NATURAL DYES | Journal of Applied Agricultural Science and Technology 5, 38 - 49, 2021 | 3 | 2021 | |
| 441 | Google Scholar | Authors : IK Budaraga | Strategi dan Peluang Pemanfaatan Teknologi Tepat Guna (TTG) dalam Meningkatkan Usaha Masyarakat | Ekasakti 131 (Vol.19 No.2 Juli 2010 ISSN 0854-8099), 13-38, 2010 | 0 | 2010 | |
| 442 | Penelitian | Merry Thressia; I Ketut Budaraga | Studi Analisa Pembangkit Listrik Tenaga Hibrid PLTM Sako dan listrik PT.PLN(Persero) Rayo Balai Selasa Kabupaten Pesisir Selatan, Sumatera Barat |
Penelitian Kompetitif Nasional ( PFR ) Leader: Rosnita Rauf Sumber: BIMA SOURCE Status: Approved Dana: Rp104.310.000 |
2024 | ||
| 443 | Google Scholar | Authors : PP Dian | Studi Ekstraksi dan Uji Karakteriasi Pigmen Angkak dari Substrat Ampas Sagu (Metroxylon Sp) sebagai Pewarna Alami | Universitas Andalas, 2018 | 0 | 2018 | |
| 444 | Google Scholar | Authors : IK Budaraga, W Winda, D Prima Putra | Study about Some Quality of Green Tea Ground with Addition of Red Ginger Powder (Zingiber Officinale Rosc) | International Journal of Life Sciences Research 5 (3), 8-17, 2017 | 0 | 2017 | |
| 445 | Google Scholar | Authors : IK Budaraga, DP Putra | Study of Antioxidant Liquid Smoke Cacao Fruit Peel Waste at Different Water Content and Pyrolysis Temperatures | 0 | 2020 | ||
| 446 | Google Scholar | Authors : IK Budaraga, RA Salihat | Study of chemical components of liquid smoke from cocoa rind in two variations of moisture content by using GC-MS method | IOP Conference Series: Earth and Environmental Science 383 (1), 012023, 2019 | 0 | 2019 | |
| 447 | Google Scholar | Authors : IK Budaraga, M Sentia | Study of determination of benzoic acid, ascorbic acid in food using high performance liquid chromatography (HPLC) method | AIP Conference Proceedings 2765 (1), 020006, 2023 | 0 | 2023 | |
| 448 | Google Scholar | Authors : IK Budaraga, N Yulita, R Ramaiyulis | Study of Escherichia Coli and Salmonella Sp. Bacterial Contamination from Meatball Seller on Bandar Buat Market in Padang City | INTERNATIONAL CONFERENCE ON GLOBAL EDUCATION, 425-433, 2022 | 0 | 2022 | |
| 449 | Google Scholar | Authors : NY I Ketut Budaraga | Study of Escherichia coliand Salmonella sp. bacterial contamination from meatball seller on Bandar Buat market in Padang City | Journal of Tropical Industrial Agriculture and Rural Development 1 (2), 52-56, 2021 | 0 | 2021 | |
| 450 | Google Scholar | Authors : IK Budaraga, DP Putra | Study of Green Tea Catechin Dipped with Moringa Leaves | IOP Conference Series: Earth and Environmental Science 515 (1), 012027, 2020 | 2 | 2020 | |
| 451 | Google Scholar | Authors : IK Budaraga, DP Putra | Study of liquid smoke toxicity cocoa shell with different purification methods | IOP Conference Series: Earth and Environmental Science 1306 (1), 012003, 2024 | 1 | 2024 | |
| 452 | Google Scholar | Authors : DP Budaraga, I.K. , Putra | Study of liquid smoke toxicity cocoa shell with different purification methods8 | IOP Conference Series: Earth and Environmental Science 1 (IOP), 8, 2024 | 0 | 2024 | |
| 453 | Google Scholar | Authors : IK Budaraga, DP Putra | Study of the physical properties of liquid smoke from cocoa rind on moisture content and different pyrolysis temperature | IOP Conference Series: Earth and Environmental Science 542 (1), 012045, 2020 | 2 | 2020 | |
| 454 | Google Scholar | Authors : LH I ketut Budaraga, Yossi Oktavia | Study of the Quality chemical of Fresh Drinks Corens with the Use of Different Types of Oranges | International Journal of ChemTech Research 11 (11), 1-8, 2018 | 0 | 2018 | |
| 455 | Google Scholar | Authors : IK Budaraga, E Susanti | Study of Toxicity of Cacao Skin Liquid (Theobroma cacao, L) Using BSLT Method (Brine Shrimp Lethality Test) | International Journal of ChemTech Research 12 (5), 8-17, 2019 | 0 | 2019 | |
| 456 | Google Scholar | Authors : IK Budaraga | Study On The Use Of Green Bean As Skim Milk Substitution In Yellow Pumpkin (Cucurbita Maxima) | UNES Journal Of Community Service 2 (2), 2016 | 0 | 2016 | |
| 457 | Google Scholar | Authors : W Budaraga IK, Rahmita, Gusriati, Leffy Hermalena | Study on the Use of Green Bean as Skim Milk Substitution in Yellow Pumpkin (Cucurbita maxima) Ice Cream | Proceedings of AESAP 2016 1 (-), 15-27, 2016 | 0 | 2016 | |
| 458 | Google Scholar | Authors : N Nordin, M Tan, AN Latfa, P Tambahan, K Disini, SPM KeDiPay, ... | Sub Tema | 0 | 0000 | ||
| 459 | Google Scholar | Authors : SH Yodi, EA Fitria, RA Salihat, I Sidabalok, L Hermalena, W Sumarno | SUBSITUTION OF SEMOLINA FLOUR WITH SABA BANANA PEEL FLOUR (Musa balbisiania L.) IN MAKING BLACK SPAGHETTI | SAGU 23 (2), 59-65, 2025 | 0 | 2025 | |
| 460 | Google Scholar | Authors : N Yessirita, L Hermalena, I Ayesha | SUBSTITUSI TEPUNG SINGKONG FERMENTASI (MOCAF) DENGAN TEPUNG TERIGU PADA PEMBUATAN MIE KERING | 1 | 2021 | ||
| 461 | Google Scholar | Authors : I Sidabalok, A Kasirang | Suriani.(2014). Pemanfaatan limbah organik menjadi kompos | Jurnal Ipteks NGAYAH 5 (2), 85-94, 0 | 33 | 0000 | |
| 462 | Google Scholar | Authors : DP Putra, TC Sunarti, K Syamsu, F Fahma | Sustainability of coffee solid waste as a source of chlorogenic acid to food's antimicrobial and antioxidant application | Discover Food 5 (1), 177, 2025 | 0 | 2025 | |
| 463 | Google Scholar | Authors : I Ayesha, R Elizabeth, L Hermalena | Sustainable Supply Chain Optimization Through The Implementation Of Iot Technology And Risk Management: The Role Of Product Quality Intervention | Management Studies and Entrepreneurship Journal (MSEJ) 4 (6), 9802-9809, 2023 | 0 | 2023 | |
| 464 | Google Scholar | Authors : D Syukri, R Bahar, A Jessica, N Novelina, PD Hari, RM Fiana, T Anggraini, ... | Technical Assistance in Determining the Heat Adequacy Number (F0) in the Sterilization Process of Packaged Rendang for Rendang Business Actors IKABOGA in Padang City | Andalasian International Journal of Social and Entrepreneurial Development 4 …, 2024 | 1 | 2024 | |
| 465 | Buku | Leffy Hermalena, Henny Puspita sari, Herda Gusvita, Nita Yessirita, Syamsuwirman | TEKHNOLOGI PENGEMBANGAN PAKAN PROBIOTIK DAN HASIL OLAHAN IKAN LELE | LPPM AAI Padang | 2024 | ||
| 466 | Google Scholar | Authors : L Hermalena, HP Sari, H Gusvita, N Yessirita, Syamsuwirman | TEKHNOLOGI PENGEMBANGAN PAKAN PROBIOTIK DAN HASIL OLAHAN IKAN LELE | ISBN : 9786239839925 1, 60, 2024 | 0 | 2024 | |
| 467 | Buku | Nurhayati, I Ketut Budaraga, Nurul Fajrih H., Soraya Kusuma Putri, Juni Sumarmono, Rahmaniar, Rifda Naufalin, Santi Dwi Astuti, Sri Widowati | TEKNIK EVALUASI SENSORI PRODUK PANGAN | CV HEI Publishing | 2024 | ||
| 468 | Buku | Prof. Dr. Ir. I Ketut Budaraga, M.Si. CIRR, Rera Aga Salihat, S.Si., M.Si, Eddwina Aidila Fitria, STP., M.Si | Teknologi dan karakteristik keju lunak : produksi, mutu, dan inovasi | CV. Hei Publishing Indonesia | 2025 | ||
| 469 | IPRs | I Ketut Budaraga, Rera Aga Salihat,Eddwina Aidila Fitria | TEKNOLOGI DAN KARAKTERISTIK KEJU LUNAK :PRODUKSI, MUTU DAN INOVASI | EC002025119777 | 2025 | ||
| 470 | Google Scholar | Authors : IK Budaraga, RA Salihat, EA Fitria | Teknologi Dan Karakteristik Keju Lunak: Produksi, Mutu, Dan Inovasi | Hei Publishing, 2025 | 0 | 2025 | |
| 471 | Google Scholar | Authors : IK Budaraga | Teknologi Ekstruksi Pada Pangan | Hei Publishing Indonesia, 2024 | 0 | 2024 | |
| 472 | Google Scholar | Authors : DE Ropiudin, Ropiudin and Rusman, Rusman and Rachmanita, Risse Entikaria and ... | Teknologi Energi Terbarukan | 0 | 2024 | ||
| 473 | Google Scholar | Authors : D I Ketut Budaraga | Teknologi Pembuatan Pupuk Organik Majemuk Lengkap dengan Memanfaatkan Bioteknologi NT 45 | Ekotrans 183 (Vol 9 No. 2 Juli 2009 ISSN 1411-4615), 21-27, 2009 | 0 | 2009 | |
| 474 | Buku | Nurhayati, Chatarina Lilis Suryani, Anna Permatasari Kamarudin, Rohadi, I Ketut Budaraga, Pahman Habibi [dan 7 lainnya] ; editor, Nur Ahmad Habibi, S.Gz., M.P., : Muslimah, S.Tr.Kes., | TEKNOLOGI PENGOLAHAN DAN HASIL PERTANIAN | Hei Publishing Indonesia | 2024 | ||
| 475 | Google Scholar | Authors : Rahmawati, DE Kuliahsari, E Rusliana, M Saleh, DA Putri, AD Pamujiati, ... | TEKNOLOGI PENGOLAHAN DAN HASIL PERTANIAN | 0 | 2024 | ||
| 476 | Google Scholar | Authors : MP Wisnubroto, P Juanti, RU Budiandari, IK Budaraga, T Kumala, ... | TEKNOLOGI PENGOLAHAN HASIL PERKEBUNAN | CV HEI PUBLISHING INDONESIA, 2024 | 0 | 2024 | |
| 477 | Google Scholar | Authors : IK Budaraga | Teknologi Pengolahan Kelapa Sawit | Hei Publishing Indonesia, 2024 | 0 | 2024 | |
| 478 | Buku | Nurhayati, I Ketut Budaraga, Nurul Fajrih H., Soraya Kusuma Putri, Juni Sumarmono, Rahmaniar, Rifda Naufalin, Santi Dwi Astuti, Sri Widowati | TEKNOLOGI PENGOLAHAN KELAPA TERPADU BESERTA BERBAGAI TUTORIAL PENGOLAHAN POHON KELAPA | CV HEI Publishing | 2024 | ||
| 479 | IPRs | I Ketut Budaraga, Mac Aditiawarman, Andy Amiruddin, Hary Fandeli, Wawan Sumarno, Rera Agung Syukra | TEKNOLOGI PENGOLAHAN KELAPA TERPADU BESERTA BERBAGAI TUTORIAL PENGOLAHAN POHON KELAPA | EC00202470953 | 2024 | ||
| 480 | Buku | Marsetyo dkk/Editor: Eddy Jajang Jaya Atmaja | TEKNOLOGI PENGOLAHAN PAKAN DAN NUTRISI TERNAK | CV Hei Publishing | 2025 | ||
| 481 | Google Scholar | Authors : MWLSDAAHDANARNYNDS Hafsah | Teknologi Pengolahan Pakan dan Nutrisi Ternak | 0 | 2025 | ||
| 482 | IPRs | Ari Kristiningsih Sawarni Hasibuan Hermawan Samsu Adi Rahman Nurhayati Adrianus Orias Willem Kaya Dheasy Herawati Salnida Yuniarti Lumbessy I Ketut Budaraga,Fadly Irmawan | Teknologi Pengolahan Rumput Laut | EC00202497329 | 2024 | ||
| 483 | Google Scholar | Authors : S Nurjanah, K Syska, N Diniyah, IK Budaraga, G Setiavani, E Verawati | Teknologi Tepat Guna Dan Ilmu Terapan | Hei Publishing Indonesia, 2024 | 1 | 2024 | |
| 484 | Buku | Nurhayati, I Ketut Budaraga, Nurul Fajrih H., Soraya Kusuma Putri, Juni Sumarmono, Rahmaniar, Rifda Naufalin, Santi Dwi Astuti, Sri Widowati | Teknologi Tepat Guna dan Teknologi Terapan | CV HEI Publishing | 2024 | ||
| 485 | Google Scholar | Authors : IK Budaraga | Telur Sebagai Bahan Pangan | Hei Publishing Indonesia, 2024 | 0 | 2024 | |
| 486 | Google Scholar | Authors : IK Budaraga | Tempurung Kelapa Untuk Mengawetkan Ikan | Jurnal: Samudra 6 (64), 26-27, 2008 | 0 | 2008 | |
| 487 | Google Scholar | Authors : IK Budaraga | Tesis Pengkajian Respirasi Buah Mangga dan Salak Terolah Minimal Selama Penyimpanan | Program Studi Teknik Pasca Panen Institut Pertanian Bogor, 1998 | 0 | 1998 | |
| 488 | Google Scholar | Authors : IK Budaraga, DP Putra | Test Liquid Smoke Toxicity for Cocoa Skin (Theobroma cacao L.) With The BSLT Method at Different Pyrolysis Temperature | ICBEAU 741 (2021), 1-9, 2021 | 3 | 2021 | |
| 489 | Google Scholar | Authors : IK Budaraga, DP Putra | Test liquid smoke toxicity for cocoa skin [Theobroma Cacao L.] with the BSLT method at different pyrolysis temperatures | IOP Conference Series: Earth and Environmental Science 741 (1), 012011, 2021 | 3 | 2021 | |
| 490 | Garuda | Satri Wilanda; Nita Yessirita; I Ketut Budaraga | The Antioxidant Characteristics of The Liquid Smoke of Cocoa Shell ( Theobroma cacao, l ) In Different Water Content Variations | Jurnal Research Ilmu Pertanian Vol. 1 No. 1 (2021): Jurnal Research Ilmu Pertanian (Februari 2021)76-83 | Accred : Unknown | 2019 | |
| 491 | Google Scholar | Authors : IK Budaraga, R Ramaiyulis, E Susanti, A Asnurita, E Nurdin | The antioxidant characteristics of the liquid smoke of cocoa shell (Theobroma cacao, L) in different water content variations | Journal of Applied Agricultural Science and Technology 3 (2), 226-238, 2019 | 9 | 2019 | |
| 492 | Google Scholar | Authors : I Sidabalok, JH Harefa, A Asnurita, YA Tahir, A Afrida | The Characteristics of Biscuit Quality with Coffee (Coffea Arabica L.) Silver Skin Flour Substitution | Jurnal Teknik Pertanian Lampung (Journal of Agricultural Engineering) 12 (4 …, 2023 | 0 | 2023 | |
| 493 | Google Scholar | Authors : RA Salihat, IK Budaraga, D Syukri, NR Yanti, EA Fitria | The effect of addition of wuluh starfruit (Averrhoa bilimbi L.) juice as a coagulant in cottage cheese from cow's milk. | 0 | 2023 | ||
| 494 | Google Scholar | Authors : RAGA SALIHAT, IK BUDARAGA, D SYUKRI, NR YANTI, EA FITRIA | The Effect of Addition of Wuluh Starfruit (Averrhoa bilimbi L.) Juice as a Coagulant in Cottage Cheese from Cow’s Milk | 0 | 0000 | ||
| 495 | Google Scholar | Authors : IK Budaraga | The Effect of Combination of Liquid SmokeTo Degrees of Material (PH) Fillet Fish Tilapia | International Journal of ChemTech Research 11 (2), 207-218, 2018 | 1 | 2018 | |
| 496 | Google Scholar | Authors : N Yessirita, H Abbas, Y Heryandi, A Dharma | The Effect of Leucaena Leaf Meal (Leucaena leucocephala) Fermented by Bacillus laterosporus and Trichoderma viride in the Ration on Performance of Pitalah Duc... | Pakistan Journal of Nutrition 12 (7), 678-682 | 1 | 2013 | |
| 497 | Google Scholar | Authors : N Yessirita, H Abbas, Y Heryandi, A Dharma | The Effect of Leucaena Leaf Meal (Leucaena leucocephala) Fermented by Bacillus laterosporus and Trichoderma viride in the Ration on Performance of Pitalah Ducks | Pakistan Journal of Nutrition 12 (7), 678-682 | 1 | 2013 | |
| 498 | Google Scholar | Authors : N Yessirita, H Abbas, Y Heryandi, A Dharma | The effect of leucaena leaf meal (Leucaena leucochepala) fermented by Bacillus laterosporus and Trichoderma viride in the ration on Performance of Pitalah ducks | Pak. J. Nutr 12 (7), 678-682, 2013 | 2 | 2013 | |
| 499 | Google Scholar | Authors : IK Budaraga, RA Salihat | The effect of material amount in distillation tank to chemical composition of citronella oil (Cymbopogon nardus L. Rendle) | IOP Conference Series: Earth and Environmental Science 653 (1), 012043, 2021 | 4 | 2021 | |
| 500 | Google Scholar | Authors : EA Fitria, IK Budaraga, RA Salihat | The effect of wuluh starfruit (Averrhoa bilimbi L.) added on the physicochemical and antimicrobial characteristics of chitosan-PVA edible film | Future of Food: Journal on Food, Agriculture and Society 11 (5), 2023 | 2 | 2023 | |
| 501 | Google Scholar | Authors : IK Budaraga, EA Fitria, S Susilawati | The Identification of Salmonella SP on Food Preparations (Seasoning and Rakik Chips) in Padang City | Proceeding International Conference Khairun University 1 (1), 266-271, 2024 | 0 | 2024 | |
| 502 | Google Scholar | Authors : W Herman, NYDI MP | THE INFLUENCE OF PRUNING TIME OF TILLER AND COW MANURE DOSES ON GROWTH AND YIELD OF PADDY RICE (Oryza sativa L.) IN THE SRI METHOD | OSF, 2019 | 0 | 2019 | |
| 503 | Google Scholar | Authors : OF DOSE | THE NUTRITIVE VALUE OF LAMTORO LEAF MEAL | 0 | 0000 | ||
| 504 | Google Scholar | Authors : NYDI MP | THE NUTRITIVE VALUE OF LAMTORO LEAF MEAL (Leucaena leucocephala) FERMENTED BY Trichoderma viride WITH VARIATION OF DOSE AND FERMENTATION TIME AS POULTRY FEED | INA-Rxiv | 0 | 0000 | |
| 505 | Google Scholar | Authors : H Bancong, DP Putra, Nurazmi | The purposes of students in conducting thought experiments while solving physics problem | AIP Conference Proceedings 2330 (1), 050032, 2021 | 6 | 2021 | |
| 506 | Scopus | Creator : Budaraga I.K. | The quality characteristics of biscuits made with plantain and purple rice flour as substitutes for wheat flour | Potravinarstvo Slovak Journal of Food Sciences | 2 | Q3 as Journal | 2023 |
| 507 | Google Scholar | Authors : N Yessirita, RA Salihat, D Indriani, S Sunadi, NR Yanti | The study of the physicochemical properties of nata de soya with the addition of bilimbi fruit (Averrhoa bilimbi L.) juice | Food Science and Applied Biotechnology 8 (1), 136-146, 2025 | 0 | 2025 | |
| 508 | Google Scholar | Authors : IK Budaraga, RA Salihat, EA Fitria | The study of the utilization of wuluh starfruit (Averrhoa bilimbi L.) in cottage cheese from goat milk prepared with acidification method based on physicochemical … | 1 | 2023 | ||
| 509 | Google Scholar | Authors : IK Budaraga, RA Salihat, EA Fitria | The study of the utilization of wuluh starfruit (Averrhoa bilimbi L.) in cottage cheese from goat milk prepared with acidification method based on physicochemical properties … | Bulgarian Journal of Agricultural Science 29 (5), 873-881, 2023 | 4 | 2023 | |
| 510 | Scopus | Creator : Budaraga I.K. | The study of the utilization of wuluh starfruit (Averrhoa bilimbi L.) in cottage cheese from goat milk prepared with acidification method based on physicochemical properties and organoleptic evaluation | Bulgarian Journal of Agricultural Science | 1 | Q3 as Journal | 2023 |
| 511 | Google Scholar | Authors : N Yessirita, T Afriani, Sunadi | The supplementation of Amino acid Methionine-Lysine on the Protein Quality of Leucaena Leaf meal Fermented by Bacillus laterosporus | Proceeding of The fisrst international conference Technology and Bioscience …, 2017 | 0 | 2017 | |
| 512 | Google Scholar | Authors : I Sidabalok, RA Salihat | THE USE OF PINEAPPLE WASTE EXTRACT ON THE EXTRACTION OF GELATIN FROM TUNA SKIN (Thunnus albacares) | Jurnal Katalisator 6 (2), 197-210, 2021 | 1 | 2021 | |
| 513 | Google Scholar | Authors : IK Budaraga, A Arnim, Y Marlinda, U Bulain | Toxicity of liquid smoke cinnamon (Cinnamomum Burmannii) production of ways for purification and different concentration | Journal of Scientific and Research Publication 6 (7), 13-21, 2016 | 18 | 2016 | |
| 514 | Buku | Prof. Dr. Ir. I Ketut Budaraga, M.Si. CIRR, Rera Aga Salihat, S.Si., M.Si, Eddwina Aidila Fitria, STP., M.Si | Transportasi Pertanian: Kolaborasi Untuk Ketahanan Pangan | CV. Hei Publishing Indonesia | 2025 | ||
| 515 | Google Scholar | Authors : IK Budaraga | Uji Beda Pada Uji Sensoris Bahan Pangan | Hei Publishing Indonesia, 2024 | 0 | 2024 | |
| 516 | Google Scholar | Authors : UB I Ketut Budaraga, Arnim, Yetti Marlida | Uji Kinerja Alat dan Identifikasi Produk AsaCair Kayu Manis Pada Berbagai Waktu Pirolisis dan Cara Pemurnian Untuk Pengawet Filet Ikan Nila | Ekasakti 20 (1), 137-165, 2011 | 0 | 2011 | |
| 517 | Google Scholar | Authors : IK Budaraga | Uji Kinerja Alat dan Identifikasi Produk Asap Cair Kayu Manis Pada Berbagai Waktu Pirolisis dan Cara Pemurnian Untuk Pengawet Filet Ikan Nila (Oreochromis nilotica) | Buletin Ilmiah Ekasakti 20 (1), 137-165, 2011 | 0 | 2011 | |
| 518 | Google Scholar | Authors : L Hermalena, RA Salihat, J Daulay | Uji mikrobiologis fillet ikan nila dilapisi edible film pati jahe gajah | Jurnal Katalisator 7 (1), 140-147, 2022 | 2 | 2022 | |
| 519 | Google Scholar | Authors : I Sidabalok, N Yessirita, L Hermalena, RA Salihat, EA Fitria | Uji Mutu Dodol Ketan dengan Substitusi Bubur Pisang Raja (Musa acuminata) | Jurnal Research Ilmu Pertanian 5 (1), 15-23, 2025 | 1 | 2025 | |
| 520 | Google Scholar | Authors : A Mardiah, I Karina, EA Fitria | Uji Organoleptik Kesegaran Ikan Layang (Decapterus, sp) Selama Penanganan Suhu Dingin | SEMAH Jurnal Pengelolaan Sumberdaya Perairan 6 (2), 97-111, 2022 | 9 | 2022 | |
| 521 | Penelitian | Dian Pramana Putra | UJI PROKSIMAT DAN AKTIVITAS ANTIOKSIDAN BROWNIES KUKUS DAN BROWNIES PANGGANG DARI TEPUNG BERAS UNGU |
Penelitian Kompetitif Nasional ( PDP/Dosen Pemula ) Leader: Rera Aga Salihat Sumber: BIMA SOURCE Status: Approved Dana: Rp19.905.000 |
2020 | ||
| 522 | Google Scholar | Authors : NY RINGAN-RINGAN | UNES JOURNAL | 0 | 2017 | ||
| 523 | Google Scholar | Authors : B Indonesia | Unes Journal Mahasiswa Pertanian | 0 | 0000 | ||
| 524 | Google Scholar | Authors : B Indonesia | Unes Journal of Education Scienties | 0 | 0000 | ||
| 525 | Google Scholar | Authors : IK Budaraga, YM Arnim | Usman Bulanin,. 2016. Analysis Of Liquid Smoke Chemical Components With GC MS From Differenft Raw Materials Variation Production And Pyrolysis Temperature Level | International Journal of ChemTech Research 9 (6), 2016 | 4 | 2016 | |
| 526 | Google Scholar | Authors : IK Budaraga, YM Arnim | Usman Bulanin,. 2016. Antibacterial Properties of Liquid Smoke from the Production of Cinnamon How Purification and Concentration of Different | International Journal of Thesis Projects and Dissertations (IJTPD) Vol 4 …, 0 | 5 | 0000 | |
| 527 | Google Scholar | Authors : IK Budaraga, YM Arnim | Usman Bulanin,. 2016. Antioxidant Properties of Liquid Smoke Cinnamon Production of Variation Purification and Different Concentration | International Journal of Scientific & Technology Research (IJSTR). ISSN ISSN …, 2016 | 5 | 2016 | |
| 528 | Google Scholar | Authors : IK Budaraga, YM Arnim | Usman Bulanin,. 2016. Antioxidant Properties of Liquid Smoke Production Variation of Pyrolysis Temperature Raw and Different Concentration | International Journal of PharmTech Research 9 (6), 366-379, 0 | 8 | 0000 | |
| 529 | Google Scholar | Authors : IK Budaraga, YM Arnim | Usman Bulanin,. 2016. Liquid Smoke Toxicity Properties of Production of Raw Materials With Variation of Temperature and Concentration of Different | International Journal of PharmTech Research 9 (10), 0 | 9 | 0000 | |
| 530 | Google Scholar | Authors : IK Budaraga, YM Arnim | Usman Bulanin. 2016. Liquid Smoke Production Quality from Raw Materials Variation and Different Pyrolysis Temperature | International Journal of ChemTech Research 6 (3), 2016 | 4 | 2016 | |
| 531 | Google Scholar | Authors : L Hermalena, I Sidabalok, N Yessirita, G Gusriati, H Gusvita, RA Salihat, ... | UTILIZATION OF HOUSEHOLD KITCHEN ORGANIC WASTE FOR ECO-ENZYME PRODUCTION IN RAWANG SUBDISTRICT, PADANG CITY | 0 | 2025 | ||
| 532 | Google Scholar | Authors : IK Budaraga | Utilization Using Liquid Smoke Fish Fillet As Preservatives | 1 | 2014 | ||
| 533 | Google Scholar | Authors : IK Budaraga | Utilization Using Liquid Smoke Fish Fillet AsPservatives | International seminar global education 2 786 (Proceeding UNES dan UKM), 1-19, 2014 | 0 | 2014 | |
| 534 | Google Scholar | Authors : L Hermalena | Valuasi Ekonomi Kawasan Konservasi Nasional Laut Banda Provinsi Maluku | Seminar MASTER PPNS 1 (1), 5-13, 2016 | 6 | 2016 | |
| 535 | Google Scholar | Authors : L Hermalena, H Jalil, T Junaedi, I Ayesha, H Gusvita | Valuasi Ekonomi Kawasan Konservasi Perairan Kepulauan Padaido Kabupaten Biak Numfor Provinsi Papua | Journal of Scientech Research and Development 1 (1), 021-030, 2019 | 1 | 2019 | |
| 536 | Google Scholar | Authors : IK Budaraga, R Ramaiyulis, E Nurdin | Vegetable Cultivation Hydroponics System In Community Economic Zone (KEM) Kanagarian Tikalak Subdistrict X Koto Singkarak Districts Solok | Journal of Scientific and Technology Research 6 (5), 29-34, 2017 | 1 | 2017 | |
| 537 | Google Scholar | Authors : T Slot | Web Themes & Templates | 2 | 2019 | ||
| 538 | Google Scholar | Authors : I Ketut Budaraga, M Arnim | Y., & Bulanin, U.(2016). Analysis of liquid smoke chemical components with GC MS from different raw materials variation production and pyrolysis temperaturelevel | International Journal of ChemTech Research 9 (6), 694-708, 0 | 5 | 0000 | |
| 539 | Google Scholar | Authors : M Sari | Yenti, and Asnurita I dan Ketut Budaraga Universitas Ekasakti. 2017 | Pengaruh Konsentrasi Starter Acetobacter Xylinum Terhadap Mutu Nata De …, 0 | 0 | 0000 |
Statistik Kegiatan Pertahun
Statistik Kegiatan per Kategori
Sumber data: SINTA, per 7 Oktober 2025
© 2025 LPPM Universitas Ekasakti. All rights reserved.
© 2025 LPPM Universitas Ekasakti. All rights reserved.
